Figure 7. Expression changes of phased and non-phased siRNAs among the three tissues examined The expression changes of phased and non-phased siRNAs between.

Slides:



Advertisements
Similar presentations
Supplementary Figure 1. Caspase 8 expression and activation and Fas expression in NSCLC and normal lung cell lines. A Western blot analysis of DR4 and.
Advertisements

We Can Read About Mixing Colors
The Build-up of the Red Sequence at z
Rotating Magnetic Field
© red ©
Phase Difference = Phase Difference = 0.05.
Supplemental Figure 1A. A small fraction of genes were mapped to >=20 SNPs. Supplemental Figure 1B. The density of distance from the position of an associated.
Supplemental Figure 1. False trans association due to probe cross-hybridization and genetic polymorphism at single base extension site. (A) The Infinium.
An urn contains 1 green, 2 red, and 3 blue marbles. Draw two without replacement. 1/6 2/6 3/6 2/5 3/5 1/5 3/5 1/5 2/5 2/30 3/30 2/30 6/30 3/30 6/30.
Scientific Notation. = 5.4 =3.47 Write the following in standard form A 1.8 X 10⁴ B 3.47 X 10⁷ C 4.3 X 10⁰ D 5.4 X 10⁻⁴ E 5 X 10⁻⁶ F (6 X 10⁴) (7 X 10⁵)
You have 10 seconds to name…
Drought in the Western U.S.. Mean US Precipitation (in inches) Average Precipitation in 1 Year (in inches):
COLORS.
Supplemental Digital Content 4
Colors.
Kam-Hei So, Cheuk-Lun Lee, William S.B. Yeung, Kai-Fai Lee 
Key differences in protein expression and pathway activation between SCLCs and NSCLCs. A, for each cell line, protein lysates were collected and analyzed.
Election #1 Popular Vote Electoral Vote State Red Yellow
Name: _______________________________
A B C Supplementary Figure S1. Trabectedin decreases viability of primary MPM cell cultures. A and B, dose-dependent impact of trabectedin on epithelioid.
Average Number of Photons
Unit 6 New school uniforms
Harnessing the Potential of the Tea Tree Genome
A pop-up menu has been set up with pre-selected periods based on the Streamflow Sequences at this website:
Drosophila development: Scalloped and Vestigial take wing
A: OAZ1 mRNA transcript of 775-1, and parental cell lines showing the stop codon introduced by the nonsense mutations in the and transcripts,
Unit 2: LIGHT AND GEOMETRIC OPTICS
Can I color yellow?. Can I color yellow?
Plasticity of Adult Stem Cells
Cellular Clocks: Coupled Circadian and Cell Division Cycles
Volume 79, Issue 11, Pages (June 2011)
miRC134 NBS 10 siR2331 NBS 60 ATPB miRC130a5
The Translational Landscape of the Mammalian Cell Cycle
Supplemental Figure S4. Expression changes of phased and non-phased siRNAs among the three tissues examined The expression changes of phased and non-phased.
What Color is it?.
Dynamic Gene Regulatory Networks of Human Myeloid Differentiation
Edwards Allen, Zhixin Xie, Adam M. Gustafson, James C. Carrington  Cell 
Topisirovic et al., (2003) EMBO J,22:
* * Supplementary figure S4 A B C D
(red) & endothelium (green) PMCA4 (green) & DAPI (blue)
Volume 4, Issue 2, (February 2007)
Min Qin, Aslan Pirouz, Myung-Hwa Kim, Stephan R. Krutzik, Hermes J
a MELLFLGTGAGIPAKARNVTSVALKLLEERRSVWLFDCGEATQHQILHTT
Performance of FDR methods on filtered microbiome data.
Properties of proteins and residues with frequent hotspot mutations
Figure 4. Differentially expressed miRNAs and isomiRNAs between different pairs of tissues The differentially expressed miRNAs and their isomiRNAs are.
Min Qin, Aslan Pirouz, Myung-Hwa Kim, Stephan R. Krutzik, Hermes J
K-Means clustering of protein and mRNA expression patterns after PPAR agonists treatments. k-Means clustering of protein and mRNA expression patterns after.
RNA Sequencing of Stentor Cell Fragments Reveals Transcriptional Changes during Cellular Regeneration  Henning Onsbring, Mahwash Jamy, Thijs J.G. Ettema 
Volume 8, Issue 3, Pages R73-R75 (January 1998)
Alterations in mRNA 3′ UTR Isoform Abundance Accompany Gene Expression Changes in Human Huntington’s Disease Brains  Lindsay Romo, Ami Ashar-Patel, Edith.
Figure 2 Functionally significant genes
Limited transcriptomic changes upon HOTAIR RNA overexpression in MDA‐MB‐231 breast cancer cells Limited transcriptomic changes upon HOTAIR RNA overexpression.
Haploinsufficiency at the Nkx3.1 locus
1. Identify the tissue.
LEARNING STRATEGIES: TRUE COLOURS The True Colours Test.
Patterns and regulation of age‐related splicing changes.
Z-score -1 1 miR167 ARF 2 Phased siRNAs Target siR362 miRNA trigger
LEARNING STRATEGIES: TRUE COLOURS The True Colours Test.
Differential protein, mRNA, lncRNA and miRNA regulation by p53.
The C-terminal membrane-proximal region of MARCH8 interacts with TfR.
Statistical chart of significantly differentially expressed genes
Let’s Learn the Basic Colors
SiRNA directed at Ngn1 inhibited differentiation of inner ear stem cells to β-III tubulin-positive cells. a, Inner ear stem cells treated with siRNA to.
miRC134 NBS 10 siR2331 NBS 60 ATPB miRC130a5
Fig. 4 Identification of C
Genome-wide Functional Analysis Reveals Factors Needed at the Transition Steps of Induced Reprogramming  Chao-Shun Yang, Kung-Yen Chang, Tariq M. Rana 
Fig. 1 Fractional coverage of the mapping method used in this study.
Characteristic gene expression patterns distinguish LCH cells from other immune cells present in LCH lesions. Characteristic gene expression patterns distinguish.
DO NOT POST #4054 Gene expression Difference (GED) Revealed Immune Function Gene UP- or Down-regulation as Tumor-associated Inflammatory Cell (TAIC) Infiltration.
Presentation transcript:

Figure 7. Expression changes of phased and non-phased siRNAs among the three tissues examined The expression changes of phased and non-phased siRNAs between different tissues are shown. The expression changes for phasiRNAs are shown in Panel A, C, and E, and the expression changes for non-phased siRNAs are shown in Panel B, D, and E. The siRNA sequences with p< 0.005 and p<0.05 are shown in red and blue, respectively. Those sequences with FDR p ≥0.05, which are expressed at higher levels (≥5 RPM) and are regulated at least 2 fold changes, are shown in orange, while the siRNA sequences with FDR p ≥0.05, which are not expressed at higher levels (< 5RPM) or are not regulated less 2 fold changes, are shown in green.