* * * * * * * Supplemental Figure 3. GO Cellular Component Annotation Analysis of SA-Regulated Gene-Networks. We analyzed the genes in the gene-networks.

Slides:

Advertisements

Similar presentations

Cellular Networks.

Advertisements

Supplemental Figure 1 A No. at risk T T T

BME 130 – Genomes Lecture 14 Eukaryotic Genome Anatomy.

Relationship of Gene’s Type and Introns Chi K. To.

BME 130 – Genomes Lecture 7 Genome Annotation I – Gene finding & function predictions.

A B C D E F G H I J K FigS1. Supplemental Figure S1. Evolutionary relationships of Arabidopsis and tomato Aux/IAA proteins. The evolutionary history was.

Supplemental Figure 1. Levels of nitrate, carbohydrates and metabolites involved in nitrate assimilation, and the medium pH. Starch and the sum of Glucose,

Figure S1 (a) (b) Fig. S1. Hydroponics culture of Arabidopsis thaliana. (a) Illustration of the hydroponics system in the growth chamber. (b) close-up.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Figure S1. Co-expression network for MNM1: Shown is the co-expression network obtained from the ATTED-II database using MNM1 as a bait gene. The red dots.

David G. Hazlerigg, Francis J.P. Ebling, Jonathan D. Johnston

C acaatataATGGAGCGTGAGACTTCGTCATCTTCAACTCCTCCGGAGGATCTTGTTACATCGATGATCGGAAAGTTCGTCGCTGTCATGTCTA b acaatataATGGAGCGTGAGACTTCGTCATCTTCAACTCCTCCGGAGGATCTTGTTACATCGATGATCGGAAAGTTCGTCGCTGTCTTGTCTA.

From: Analysis of Rare Variants in the Complement Component 2 (C2) and Factor B (BF) Genes Refine Association for Age-Related Macular Degeneration (AMD)

Supplemental Figure-Genome alignment of TX16 and Aus0004

A. B. Supplemental Figure S2. A. Cell cycle G1/S Growth Factor Regulation. Publically available data from (20;

Volume 6, Issue 4, Pages (October 2000)

WTG BTG SAR 4 SER 5 CIS * % total reads

The Functional Impact of Alternative Splicing in Cancer

Hook Angle of Curvature, (º)

Principal component analysis of the GO category composition of all genes in each genome/transcriptome and WGD paralogs. Principal component analysis of.

Volume 126, Issue 4, Pages (April 2004)

Highly Transcribed RNA Polymerase II Genes Are Impediments to Replication Fork Progression in Saccharomyces cerevisiae Anna Azvolinsky, Paul G. Giresi,

Roger B. Deal, Steven Henikoff Developmental Cell

Supplemental Figure 1. Microarray data classification into biological processes of genes differentially expressed in PBCs between normal and overweight.

Genome-Wide Analysis of PLT2 Binding to Target Genes.

Groups 36 and 630 Group 640 Group 31 Group 5 Groups 40,41, 655 and 669

Volume 3, Issue 1, Pages (January 2013)

Volume 136, Issue 1, Pages e3 (January 2009)

Volume 85, Issue 2, Pages (January 2015)

Volume 23, Issue 4, Pages (April 2018)

Evolutionary Rewiring of Human Regulatory Networks by Waves of Genome Expansion Davide Marnetto, Federica Mantica, Ivan Molineris, Elena Grassi, Igor.

Understanding Tissue-Specific Gene Regulation

Volume 26, Issue 5, Pages (September 2013)

Volume 21, Issue 2, Pages (January 2011)

High-Resolution Expression Map of the Arabidopsis Root Reveals Alternative Splicing and lincRNA Regulation Song Li, Masashi Yamada, Xinwei Han, Uwe Ohler,

The Functional Impact of Alternative Splicing in Cancer

Enriched gene functions responding to irradiance and pO2.

Tarvinder S. Dhanjal et al. JACEP 2017;3:

Supplemental Figure 3 A B C T-DNA 1 2 RGLG1 2329bp 3 T-DNA 1 2 RGLG2

Supplemental Figure 1. total n=862

Volume 7, Issue 9, Pages (September 2014)

Parallel evolution of coding sequences above neutral expectation.

Clustered Organization of Reproductive Genes in the C. elegans Genome

Bar plot representation of the transcriptomic changes in Δsaci_ptp and Δsaci_pp2a. Bar plot representation of the transcriptomic changes in Δsaci_ptp and.

RNA Sequencing of Stentor Cell Fragments Reveals Transcriptional Changes during Cellular Regeneration Henning Onsbring, Mahwash Jamy, Thijs J.G. Ettema

Validation of ChIP-seq reads.

Comparison of proteomics and RNA‐Seq data.

Hitoshi Sawa, Hiroko Kouike, Hideyuki Okano Molecular Cell

Volume 27, Issue 5, Pages (November 2007)

Volume 27, Issue 5, Pages (November 2007)

Volume 4, Issue 1, Pages (January 2011)

Nature of Mitochondrial DNA Deletions in Substantia Nigra Neurons

Expression and Histone H4 Acetylation Levels of MAPK6 and WRKY53 in the HDT701 OX and RNAi Plants after M. oryzae Inoculation. Expression and Histone H4.

Maximum likelihood phylogeny of USA500 and other CC8 strains.

Volume 10, Issue 3, Pages (March 2017)

Volume 5, Issue 6, Pages (November 2012)

Volume 26, Issue 17, Pages (September 2016)

Tarvinder S. Dhanjal et al. JACEP 2017;j.jacep

Structure of Wt1 genomic regions in human and zebrafish.

Identification of acetylated peptides and proteins by LC-MS/MS.

Fig. 2. —Phylogenetic relationships and motif compositions of some representative MORC genes in plants and animals. ... Fig. 2. —Phylogenetic relationships.

Volume 17, Issue 16, Pages (August 2007)

David G. Hazlerigg, Francis J.P. Ebling, Jonathan D. Johnston

Lactase Haplotype Diversity in the Old World

A Light-Independent Allele of Phytochrome B Faithfully Recapitulates Photomorphogenic Transcriptional Networks Wei Hu, Yi-Shin Su, J. Clark Lagarias

C-Lineage-Dependent CRC Expression and Nectary Development in Arabidopsis and Petunia. C-Lineage-Dependent CRC Expression and Nectary Development in Arabidopsis.

Volume 16, Issue 23, Pages (December 2006)

Functional Insights of Plant GSK3-like Kinases: Multi-Taskers in Diverse Cellular Signal Transduction Pathways Ji-Hyun Youn, Tae-Wuk Kim Molecular Plant

Effect of Seed Coat Contamination on Imprinting Studies in Endosperm.

Integrated analysis of gene expression and copy number alterations.

Presentation transcript:

* * * * * * * Supplemental Figure 3. GO Cellular Component Annotation Analysis of SA-Regulated Gene-Networks. We analyzed the genes in the gene-networks responsive to SA in the seven accessions for bias in GO Cellular Component annotation. Black bars show the percentage of total annotations in each GO Cellular Component annotation classification using the sequenced Arabidopsis genome. Hatched and white bars show the percentage of total annotations for each of the above GO Cellular Component classifications for the genes present in the down- and up-regulated networks, respectively. Asterisks (*) indicate those classifications that are significantly different from the whole genome distribution as determined by chi-square tests.