iraL shares sequence identity with iraM from E

Slides:

Advertisements

Similar presentations

. Class 1: Introduction. The Tree of Life Source: Alberts et al.

Advertisements

KEY WORDS – CELLS, DNA, INFORMATION All living things are made from Deoxyribonucleic acid is abbreviated This molecule stores that helps cells carry.

KEY WORDS – CELLS, DNA, INFORMATION All living things are made from Deoxyribonucleic acid is abbreviated This molecule stores that helps cells carry.

Hosted by The Greatest Biology teachers at Rider.

Mutations Section 12–4 This section describes and compares gene mutations and chromosomal mutations.

What is comparative genomics? Analyzing & comparing genetic material from different species to study evolution, gene function, and inherited disease Understand.

Anotation: Gene of which little is known What follows is a simulation of an orf page in the proposed graphical interface. The interface does not yet exist.

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

The Central Dogma The Central Dogma traces the flow of genetic information DNA Replication, Transcription, and Translation take place in human cells as.

Finding genes in the genome

COURSE OF BIOINFORMATICS Exam_30/01/2014 A.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

SC.912.L.16.3 DNA Replication. – During DNA replication, a double-stranded DNA molecule divides into two single strands. New nucleotides bond to each.

Figure 1 Myotubularin exhibits a tyrosine phosphatase activity

C acaatataATGGAGCGTGAGACTTCGTCATCTTCAACTCCTCCGGAGGATCTTGTTACATCGATGATCGGAAAGTTCGTCGCTGTCATGTCTA b acaatataATGGAGCGTGAGACTTCGTCATCTTCAACTCCTCCGGAGGATCTTGTTACATCGATGATCGGAAAGTTCGTCGCTGTCTTGTCTA.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

22 kDa a-coixin gene cluster

Schematic drawing of the human X chromosome and physical map the Xp interval carrying the ND gene. A 640-kb yeast artificial chromosome (YAC) clone was.

Mutations Chapter 12-4.

Step 3 in Protein Synthesis

Mark M Metzstein, H.Robert Horvitz Molecular Cell

Hair Keratin Associated Proteins: Characterization of a Second High Sulfur KAP Gene Domain on Human Chromosome 211 Michael A. Rogers, Hermelita Winter,

Quiz#3 LC710 10/17/12 name____________ Q1(4%)

BIOLOGY Vocabulary Chapter 12 & 13.

Hair Keratin Associated Proteins: Characterization of a Second High Sulfur KAP Gene Domain on Human Chromosome 211 Michael A. Rogers, Hermelita Winter,

Sequence and comparison of the SDS protein.

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

Multiple sequence alignment and analysis of SOFL proteins.

Week 6 Vocab Definitions

Essential Question: How cells make proteins

Quiz#1 LC710 10/10/12 name____________

Psoriasis Upregulated Phorbolin-1 Shares Structural but not Functional Similarity to the mRNA-Editing Protein Apobec-1 Peder Madsen, Julio E. Celis,

Genomic rearrangements of E

Volume 113, Issue 5, Pages (May 2003)

A. Papa, K. Dumaidi, F. Franzidou, A. Antoniadis

Characterization of two novel gene cassettes, dfrA27 and aadA16, in a non-O1, non- O139 Vibrio cholerae isolate from China J. Sun, M. Zhou, Q. Wu, Y.

Genomic context, sequence identity, and structural homology modeling of the aadA31 gene detected in P. multocida PM13 and H. somni HS31. Genomic context,

Schematic diagrams of genomic structure, the strategy for genomic cDNA cloning, and molecular characterization of unique features of three emergent U.S.

Quiz#1a LC710 11/05/17 name____________

_____ _____ are _____ by _____ ____ sequences.

N-terminal extension of a gene using peptides mapping upstream to an annotated start site. N-terminal extension of a gene using peptides mapping upstream.

Possible secondary structure of the S. enterica prs leader.

Genetic and molecular characterization of DicF-ftsZ mRNA interactions.

Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Protein sequence alignments for the BcfD (A) and StfH (B) allelic.

IraL affects the levels and stability of σS during log phase growth.

IraL interacts with RssB.

Mutation Notes.

The ced-8 Gene Controls the Timing of Programmed Cell Deaths in C

Maternal Transmission of the 3 bp Deletion within Exon 7 of the STS Gene in Steroid Sulfatase Deficiency Margarita Valdes-Flores Journal of Investigative.

Translation converts an mRNA message into a polypeptide, or protein.

Tagging of the endogenous Py03652 gene with the gfp gene in Plasmodium yoelii. Tagging of the endogenous Py03652 gene with the gfp gene in Plasmodium yoelii.

Alignment of wild-type and mosaic Neisseria gonorrhoeae mtr promoters with N. lactamica and N. meningitidis references. Alignment of wild-type and mosaic.

Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.

Shifty Ciliates Lawrence A. Klobutcher, Philip J. Farabaugh Cell

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

(A) yellow cDNA comparison among wild-type and ch mutants

Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Alignment of the deduced amino acid sequence of rat olfactory CNCβ1b with bovine rod CNCβ1a. Alignment of the deduced amino acid sequence of rat olfactory.

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

Nucleotide sequences of the IS1016-bexAdeletion region of type b strain Hib and type a strains 1, 2, and 5. Nucleotide sequences of the IS1016-bexAdeletion.

Nucleotide and predicted amino acid sequence of the adult mouse brain cdr2 cDNA. Nucleotide and predicted amino acid sequence of the adult mouse brain.

Danna K Morris, Victoria Lundblad Current Biology

The genes pykA and xylR are posttranscriptionally regulated by DicF.

(A) Bayesian phylogenetic tree of the H gene nucleotide alignment from tigers Pt2004 and Pt and representative CDV sequences obtained from GenBank.

Comparison of the van gene clusters.

Multiple alignment of type I and III IFNs from Xenopus, chicken, and human. Multiple alignment of type I and III IFNs from Xenopus, chicken, and human.

Presentation transcript:

iraL shares sequence identity with iraM from E iraL shares sequence identity with iraM from E. coli K-12 but differs in genetic context. iraL shares sequence identity with iraM from E. coli K-12 but differs in genetic context. (A) Visualization of regions of the K-12 and CFT073 chromosomes containing iraM and iraL, respectively. Block arrows represent annotated open reading frames from these two strains, and the number below each region indicates the chromosomal location. The region immediately upstream and containing the iraL start codon is detailed. The TSS of iraL (indicated by +1 and a leftward-pointing arrow) was determined by 5′ RACE. The predicted −10 and −35 sites are in bold, and the iraL start codon is underlined. (B) Nucleotide sequence alignment of the coding regions of iraL and iraM. Alignment was carried out with the ClustalW feature and the default parameters in MacVector 9.0.2. It was determined that these genes share 67% nucleotide sequence identity. Stars below the alignment denote regions of sequence identity. (C) Alignment of the amino acid sequences of IraL and IraM. Alignment was carried out with ClustalW as described above. It was determined that these polypeptides share 58.9% amino acid sequence identity. Stars below the alignment denote regions of sequence identity, while periods represent regions of weak similarity. Andrew J. Hryckowian et al. mBio 2014; doi:10.1128/mBio.01043-14