Identification of the GCS1 ortholog in Gonium pectorale.

Slides:

Advertisements

Similar presentations

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

Advertisements

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Supplemental Fig. S1 A B AtMYBS aa AtMYBS

C acaatataATGGAGCGTGAGACTTCGTCATCTTCAACTCCTCCGGAGGATCTTGTTACATCGATGATCGGAAAGTTCGTCGCTGTCATGTCTA b acaatataATGGAGCGTGAGACTTCGTCATCTTCAACTCCTCCGGAGGATCTTGTTACATCGATGATCGGAAAGTTCGTCGCTGTCTTGTCTA.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Figure 1. Structure of the fly LGR2 gene and the corresponding cDNA sequence. A, Derivation of the fly LGR2 full-length cDNA from the genomic sequence.

Fig. 1. (A) The nucleotide and deduced amino acid sequences of the vacuolar serine protease protein of F. proliferatum (Fus p , GenBank accession.

CYB561 mutations. CYB561 mutations. The upper part shows the structure of the CYB561 gene, with the positions of the identified mutations indicated. Gray.

Volume 137, Issue 2, Pages (April 2009)

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

The TNF and TNF Receptor Superfamilies

Multiple sequence alignment and analysis of SOFL proteins.

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

by Parisa Asvadi, Zohra Ahmadi, and Beng H. Chong

FcRL6, a new ITIM-bearing receptor on cytolytic cells, is broadly expressed by lymphocytes following HIV-1 infection by Timothy J. Wilson, Rachel M. Presti,

A Hypervariable Invertebrate Allodeterminant

Eija Siintola, Meral Topcu, Nina Aula, Hannes Lohi, Berge A

Volume 84, Issue 3, Pages (February 1996)

Identification of cDNA Encoding a Serine Protease Homologous to Human Complement C1r Precursor from Grafted Mouse Skin Sung June Byun, Young Yil Bahk,

The Transmembrane Kinase Ire1p Is a Site-Specific Endonuclease That Initiates mRNA Splicing in the Unfolded Protein Response Carmela Sidrauski, Peter.

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

(A) Six missense mutations in six essential genes that are not in annotated functional domains. (A) Six missense mutations in six essential genes that.

Size Polymorphisms in the Human Ultrahigh Sulfur Hair Keratin-Associated Protein 4, KAP4, Gene Family Naoyuki Kariya, Yutaka Shimomura, Masaaki Ito

Figure 1: The full-length cDNA and deduced amino acid sequences of Lysozyme C and amino acid sequences from rock bream, Oplegnathus fasciatus. The primers.

Antigenic Variation in Malaria

Identification, description, and expression of E7-less STING isoforms.

Schematic diagrams of genomic structure, the strategy for genomic cDNA cloning, and molecular characterization of unique features of three emergent U.S.

Clustering of Activating Mutations in c-KIT’s Juxtamembrane Coding Region in Canine Mast Cell Neoplasms Yongsheng Ma, B. Jack Longley, Xiaomei Wang

Phosphorylation of Serine 2 within the RNA Polymerase II C-Terminal Domain Couples Transcription and 3′ End Processing Seong Hoon Ahn, Minkyu Kim, Stephen.

lin-35 and lin-53, Two Genes that Antagonize a C

A Novel Class of MYB Factors Controls Sperm-Cell Formation in Plants

Sadaf Naz, Chantal M. Giguere, David C. Kohrman, Kristina L

WRKY20 dual sgRNA approach.

Exon Junction Sequences as Cryptic Splice Sites

Cell Signalling: Receptor orphans find a family

Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development K. Kosaki,

Model of the stepwise regulation of localization of GpGCS1 specifically to the minus TMS. The GpGCS1 protein level is enriched in minus gametes by transcriptional.

Phylogeny of GCS1/HAP2 proteins from various eukaryotic lineages, including GpGCS1 identified in this study. Phylogeny of GCS1/HAP2 proteins from various.

Stella Plakidou-Dymock, David Dymock, Richard Hooley Current Biology

Immunoblot analysis of GpGCS1 expression in strains K41 (mating-type plus) and K34 (mating-type minus). Immunoblot analysis of GpGCS1 expression in strains.

AKAP15 coimmunoprecipitates with CaV1

Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.

The C-terminal membrane-proximal region of MARCH8 interacts with TfR.

Amino acid sequence deduced from the sequence of contig 131 of G

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Schematic representation of the domain structures of insect enzymes involved in chitin metabolism. Schematic representation of the domain structures of.

(A) yellow cDNA comparison among wild-type and ch mutants

Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

General structure of RIFINs and STEVORs

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Immunofluorescence analysis of GpGCS1 localization in strains K41 (mating-type plus) and K34 (mating-type minus). Immunofluorescence analysis of GpGCS1.

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Identification of TSIX, Encoding an RNA Antisense to Human XIST, Reveals Differences from its Murine Counterpart: Implications for X Inactivation Barbara.

Semiquantitative RT-PCR of GpGCS1 expression in strains K41 (mating-type plus) and K34 (mating-type minus). Semiquantitative RT-PCR of GpGCS1 expression.

BnmAbs 3D3 and 2D10 bind RSV G bnmAbs 3D3 and 2D10 bind RSV G (A) Schematic of the RSV G glycoprotein from RSV strain A2, including the.

Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins. Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins.

Extracellular Proteins Needed for C. elegans Mechanosensation

Comparison of the sequences of Fzo/Mfn and structure of mammalian Mfn2

Alignment of the deduced amino acid sequence of rat olfactory CNCβ1b with bovine rod CNCβ1a. Alignment of the deduced amino acid sequence of rat olfactory.

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

The zebrafish ortholog of human JunB is expressed in the zebrafish heart. The zebrafish ortholog of human JunB is expressed in the zebrafish heart. (A)

Cecilia P. Sanchez, Paul Horrocks, Michael Lanzer Cell

M L L L V L L V V L I L L I V R R Predicted transmembrane domain

ROS Generation, Defense Gene Expression, and Histone Acetylation Levels in the HDT701 OX and RNAi Plants.(A) ROS level in HDT701 RNAi plants after flg22.

Volume 97, Issue 6, Pages (June 1999)

A, Schematic diagram of identified splice variants of PD-L1.

S. moellendorffii BBI3 Is Predicted to Be a BBI Based on Sequence Similarity at the Inhibitory Motifs and Shared Primary Protein Architecture. S. moellendorffii.

Multiple alignment of type I and III IFNs from Xenopus, chicken, and human. Multiple alignment of type I and III IFNs from Xenopus, chicken, and human.

Identification of the translation products of the XAGE-1 variants.

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

Identification of the GCS1 ortholog in Gonium pectorale. Identification of the GCS1 ortholog in Gonium pectorale. (A) Structure of the GpGCS1 gene. Solid and open boxes represent coding and noncoding exon sequences, respectively. Solid lines indicate introns. Polyadenylation sites and the positions of primers used for RT-PCR analysis are also indicated. (B) Alignment of deduced amino acid sequences of GCS1/HAP2 from G. pectorale (upper) and C. reinhardtii (lower). Identical and similar residues are shaded in black and gray, respectively. Signal sequences, HAP2-GCS1, and transmembrane domains are indicated by boxes. Asterisks within the HAP2-GCS1 domain represent invariant cysteine residues conserved among the GCS1/HAP2 homologs. Open triangles indicate putative N-glycosylation sites. The region corresponding to the antigen used to generate anti-GpGCS1 antibody is also marked. Hiroko Kawai-Toyooka et al. Eukaryotic Cell 2014; doi:10.1128/EC.00330-13