Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.

Slides:

Advertisements

Similar presentations

MVKFLFSVIILFFLLSAVGSSARNIEEDGVIRLPSEVKDFINGKNIDDDSVGGTRWAVLI 60 AGSSGYWNYRHQADVCHAYQVLKRGGVKDENIVVFMYDDIALNEENPRPGVIINHPKGED 120 VYAGVPKDYTGRDVTAHNFYSVLLGNKTAVKGGSGKVIDSGPNDHIFIYYSDHGGPGVLG.

Advertisements

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

Etheridge_Fig. S1 NTD * * (368) (154) (296) (131) (146) (477) (271) (391) (141) (248) CTDCTD (570) (363) (483) (232) (340) (675) (446) (588) (318) (422)

Figure 1. Structure of the fly LGR2 gene and the corresponding cDNA sequence. A, Derivation of the fly LGR2 full-length cDNA from the genomic sequence.

Fig. 1. (A) The nucleotide and deduced amino acid sequences of the vacuolar serine protease protein of F. proliferatum (Fus p , GenBank accession.

Molecular characterization and expression of a novel human leukocyte cell-surface marker homologous to mouse Ly-9 by Miguel Angel de la Fuente, Victoria.

Enrichment of sequence disorder in the cytosolic phosphoproteome.

(A) Stereoview of the active site of IspH with bound HMBPP (Green) including coordinated water at position W1 (Gray). (A) Stereoview of the active site.

Relation of FRET change to fusion pore opening and dilation.

RELT, a new member of the tumor necrosis factor receptor superfamily, is selectively expressed in hematopoietic tissues and activates transcription factor.

Stereoview of the structural superposition of IspH protein from E

Sequence and comparison of the SDS protein.

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

The circadian clock modulates the size control in 12:12 LD cycles.

Characterization of Siglec-5, a Novel Glycoprotein Expressed on Myeloid Cells Related to CD33 by Ann L. Cornish, Sylvie Freeman, Gareth Forbes, Jian Ni,

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

Cryo-EM structure of I27[L = 35] RNCs

by Parisa Asvadi, Zohra Ahmadi, and Beng H. Chong

The Crystal Structure of a Laminin G–like Module Reveals the Molecular Basis of α- Dystroglycan Binding to Laminins, Perlecan, and Agrin Erhard Hohenester,

Volume 57, Issue 5, Pages (May 2000)

Phosphopeptides identified harboring minimal binding motifs

Psoriasis Upregulated Phorbolin-1 Shares Structural but not Functional Similarity to the mRNA-Editing Protein Apobec-1 Peder Madsen, Julio E. Celis,

Putative pathogenic variants in KLB identified in congenital hypogonadotropic hypogonadism Putative pathogenic variants in KLB identified in congenital.

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

Table 1. Occurrence of N-X-S/T motives in tryptic peptides1

A Novel MAP Kinase Regulates Flagellar Length in Chlamydomonas

STAT Genes Found in C. elegans

Clustering of Activating Mutations in c-KIT’s Juxtamembrane Coding Region in Canine Mast Cell Neoplasms Yongsheng Ma, B. Jack Longley, Xiaomei Wang

Figure 2 Schematic displaying the 3 described CHT mutant proteins alongside wild type molecule (Adapted from reference 2, using Microsoft Powerpoint Software)‏

Volume 23, Issue 4, Pages (April 2015)

Molecular Analysis of Mammalian Timeless

Yusuke Nakasone, Kazunori Zikihara, Satoru Tokutomi, Masahide Terazima

Volume 9, Issue 8, Pages (August 2001)

Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Protein sequence alignments for the BcfD (A) and StfH (B) allelic.

ECOM method recovers time correlation with 2-ms precision from 219-ms imaging frames. ECOM method recovers time correlation with 2-ms precision from 219-ms.

A Novel Family of Mammalian Taste Receptors

SDS-PAGE of IGFBP-5 from 32P-labeled T47D cells and separation of tryptic phosphopeptides separated by HPLC.a, an autoradiograph (lane 1) is shown next.

iraL shares sequence identity with iraM from E

Identification of the GCS1 ortholog in Gonium pectorale.

Phylogenetic analysis and amino acid sequences comparison of HO endonucleases. Phylogenetic analysis and amino acid sequences comparison of HO endonucleases.

AKAP15 coimmunoprecipitates with CaV1

Kun Wang, Bing Zhou, Yien-Ming Kuo, Jason Zemansky, Jane Gitschier

Sequence conservation across the Ub-binding sites of human USPs

Structure of STAT6CF and N4 site DNA complex.

Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.

The saturation scan database for Ubv.2.1 (A) and Ubv.21.4 (B).

An alignment of vertebrate preproendothelin-1 protein sequences.

Amino acid sequence deduced from the sequence of contig 131 of G

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

General structure of RIFINs and STEVORs

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

BnmAbs 3D3 and 2D10 bind RSV G bnmAbs 3D3 and 2D10 bind RSV G (A) Schematic of the RSV G glycoprotein from RSV strain A2, including the.

Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins. Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins.

Phosphopeptides identified harboring minimal binding motifs

The Crystal Structure of a Laminin G–like Module Reveals the Molecular Basis of α- Dystroglycan Binding to Laminins, Perlecan, and Agrin Erhard Hohenester,

Comparison of the sequences of Fzo/Mfn and structure of mammalian Mfn2

Alignment of the deduced amino acid sequence of rat olfactory CNCβ1b with bovine rod CNCβ1a. Alignment of the deduced amino acid sequence of rat olfactory.

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

Epiplakin binds to keratins via multiple sites.

Crystal Structure of the Extracellular Domain of a Human FcγRIII

The zebrafish ortholog of human JunB is expressed in the zebrafish heart. The zebrafish ortholog of human JunB is expressed in the zebrafish heart. (A)

Cecilia P. Sanchez, Paul Horrocks, Michael Lanzer Cell

Hymenoptera venom protease allergens

Nucleotide and predicted amino acid sequence of the adult mouse brain cdr2 cDNA. Nucleotide and predicted amino acid sequence of the adult mouse brain.

Primary structure of zebra finch CREB

Multiple alignment of type I and III IFNs from Xenopus, chicken, and human. Multiple alignment of type I and III IFNs from Xenopus, chicken, and human.

Sequence alignment of colicin lysis proteins.

Scheme showing the secondary structure assignment of human PAH sequence (SWISS-PROT P00439). Scheme showing the secondary structure assignment of human.

Presentation transcript:

Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. The amino acid sequences of mammalian HB-EGF proteins were downloaded from the Swiss-Prot database. The numbers indicate the amino acid numbers of the putative chicken HB-EGF. The dark gray areas indicate identical amino acids, and light gray areas indicate similar amino acids. The alignment was generated with the program clustalw alignment. The arrows mark the amino acid sequence of predicted, mature-secreted HB-EGF. The black dot designates the potential glycosylation site, threonine-89. The dashed lines mark the heparin-binding sites. The transmembrane domain is underlined. Swiss-Prot database accession numbers are Q99075 (human HB-EGF), Q061767 (rat HB-EGF), and Q06186 (mouse HB-EGF). The chicken HB-EGF has been deposited in GenBank (accession no. AF131224). Shu-ling Fu et al. PNAS 1999;96:10:5716-5721 ©1999 by National Academy of Sciences