Fig. 4. transparent encodes Mpv17.(A) tra maps to chromosome 20.

Slides:

Advertisements

Similar presentations

Precise Manipulation of Chromosomes in Vivo Enables Genome-Wide Codon Replacement Isaacs, Farren J. et al. Science, Vol 333, 2011 Presented by: PJ Velez.

Advertisements

TRANSLATION The process of converting the information stored in mRNA into a protein is called translation mRNA carries information from a gene to a structure.

The Genetic Code. The DNA that makes up the human genome can be subdivided into information bytes called genes. Each gene encodes a unique protein that.

The Central Dogma The Central Dogma traces the flow of genetic information DNA Replication, Transcription, and Translation take place in human cells as.

 During replication (in DNA), an error may be made that causes changes in the mRNA and proteins made from that part of the DNA  These errors or changes.

A change in the nucleotide sequence of DNA Ultimate source of genetic diversity Gene vs. Chromosome.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

22 kDa a-coixin gene cluster

The ABC’s of DNA Barry Bowman.

Gene Mutations.

Types of Mutations.

The Chimpanzee Genome Motivation for sequencing

Mark M Metzstein, H.Robert Horvitz Molecular Cell

Volume 8, Issue 2, Pages (August 2001)

Mutations & Genetic Engineering

A Gene Mutated in Nephronophthisis and Retinitis Pigmentosa Encodes a Novel Protein, Nephroretinin, Conserved in Evolution Edgar Otto, Julia Hoefele,

Volume 91, Issue 6, Pages (December 1997)

Sightless has homology to transmembrane acyltransferases and is required to generate active Hedgehog protein Jeffrey D. Lee, Jessica E. Treisman Current.

Imprinted chromosomal regions of the human genome display sex-specific meiotic recombination frequencies Andràs Pàldi, Gàbor Gyapay, Jacques Jami Current.

(A) Schematic of the TGGT1_254250/TgPRELID gene, mRNA, and predicted protein. (A) Schematic of the TGGT1_254250/TgPRELID gene, mRNA, and predicted protein.

sac mutants are hypersensitive to IR

Mutation Notes.

Shifty Ciliates Lawrence A. Klobutcher, Philip J. Farabaugh Cell

Fig. 2. Effect of endurance training on gene expression, and protein content and activity in heart muscle. Effect of endurance training on gene expression,

Fig. 7. Motion adaptation increases time-dependent response modulations (TDRM) relatively to the average cell response.TDRM normalized to the value obtained.

A highly conserved six-amino-acid region in the C-terminal CT domain of MARCH8 is responsible for its ability to downregulate TfR. A highly conserved six-amino-acid.

Fig. 4. The model of malate metabolism in fruit cells under different K level conditions. The model of malate metabolism in fruit cells under different.

Fig. 4. Mutations induced by TALENs are heritable through the germline

Fig. 2. Validating the efficiency of smc3 MOs

Table 3. Penetrance of cuticle defects seen in ush2 mutants embryos and in the progeny from rescue experiments (genotypes indicated in the table) with.

Fig. 5. GFP fluorescence colocalization of Gcn5.

Fig. 7. Interaction between BAF60c and cardiac transcription factors.

Fig. 1. Fusion protein amino acid sequences. Chick CaV2

Fig. 1. Generation of WNK3 knockout mice

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Fig. 4. The predicted protein domains in sma

Cre-loxP-mediated chromosomal engineering in mice.

Comparison ofMyc-induced zebrafish liver tumors with different stages of human HCC and seven mouse HCC models. Comparison ofMyc-induced zebrafish liver.

Statistical chart of significantly differentially expressed genes

Fig. 4. Quantitative mRNA expression of two membrane-bound trehalase genes in Harmonia axyridis in response to starvation (0–72 h). Quantitative mRNA expression.

Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

Amino acid sequence homology between XLMO-2 and the mouse, human and zebrafish homologs. Amino acid sequence homology between XLMO-2 and the mouse, human.

General structure of RIFINs and STEVORs

Fig. 3. idefix mutant chromatophores contribute to a wild-type pattern in chimeric animals. idefix mutant chromatophores contribute to a wild-type pattern.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Fig. 2. RGD and KGD motifs in N. vectensis thrombospondins

Fig. 2 Overview of transcriptional mutagenesis in yeast.

Fig. 6. F1 trβ mutants accomplish natural metamorphosis.

Understanding Fragile X Syndrome

Fig. 3. Parp mutation rescues mitochondrial function in pink1 mutants.

Amplicon sequencing analysis of on-target sites in trβ crispants

Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins. Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins.

Figure 1 Schematic of the OPA3 gene and OPA3 protein isoform b

Fig. 12. Overview of the molecular program essential to build mdDA neurons.The genes identified in this study (in red) have been added to the programming.

Fig. 3. transparent is required cell-autonomously in iridophores

Single-cell atlas of lincRNA expression during mESC to NPC differentiation. Single-cell atlas of lincRNA expression during mESC to NPC differentiation.

Fig. 8. Expression of other genomic-clustered Chrn subunits in the mesodiencephalon.(A) Schematic representation illustrating the assembly of the Chrnb4,

The C2H2 zinc-finger factor ztf-16 is required for ver-1 expression.

Membrane integration of the model constructs depends on protein sequence, not codon usage. Membrane integration of the model constructs depends on protein.

Structural insights based on chimeric Alp4-GCP2 analysis.

The zebrafish ortholog of human JunB is expressed in the zebrafish heart. The zebrafish ortholog of human JunB is expressed in the zebrafish heart. (A)

AP2μ2 has an essential function in Wnt/β-Catenin signaling.

Nucleotide and predicted amino acid sequence of the adult mouse brain cdr2 cDNA. Nucleotide and predicted amino acid sequence of the adult mouse brain.

Genomic Sequence of Ufo1-1 Reveals a Novel CACTA Transposon Insertion in the Candidate Gene. Genomic Sequence of Ufo1-1 Reveals a Novel CACTA Transposon.

Structures of wild-type and mutated recombinant CDX2.

A, Schematic diagram of identified splice variants of PD-L1.

Comparison of the van gene clusters.

Presentation transcript:

Fig. 4. transparent encodes Mpv17.(A) tra maps to chromosome 20. transparent encodes Mpv17.(A) tra maps to chromosome 20. The genomic interval was mapped by the indicated microsatellites (z-marker) and further refined by SNPs located on contigs BX596783 and BX511178. Brackets give the number of recombinants in relation to the total number of mutant individuals. In this closest interval, 7 genes are annoted. (B) Sequencing revealed a deletion in the mpv17 coding sequence in tra mutants, resulting in a frameshift (D, amino acids in pink) and an early stop codon. (C) Comparison of zebrafish (Dr) Mpv17 protein sequence and its human homolog (Hs). The proteins show 69% amino acid identity. Amino acids forming the transmembrane domains are highlighted in red. The mitochondrial target signal in the human protein sequence is underlined. (D) Injection of mpv17 or mpv17:egfp encoding mRNA into tra mutants rescue larval iridophore pigmentation (n(uninjected) = 167, n(mpv17) = 299, n(mpv17:egfp) = 300). Jana Krauss et al. Biology Open 2013;2:703-710 © 2013. Published by The Company of Biologists Ltd