Sequence novelty among SSUnique pipeline-filtered OTUs (unclassified at the class level) in the Earth Microbiome Project (EMP) and Human Microbiome Project.

Slides:

Advertisements

Similar presentations

The Build-up of the Red Sequence at z

Advertisements

NCBI BLAST, CDD, Mini-courses Katia Guimarães 2007/2.

Why NCBI Tools are important for breeding plants studies genetically modified organism: the impossibility of intergenic crosses caused by the genetic incompatibility.

+ Wrap up and future studies October 1st, Outcome: this could not have been more successful.

BLAST Sequence alignment, E-value & Extreme value distribution.

Bioinformatics and Phylogenetic Analysis

BLAST Tutorial 3 What is BLAST? Basic Local Alignment Search Tool Is a set of similarity search programs designed to explore sequence databases. What are.

Kate Milova MolGen retreat March 24, Microarray experiments. Database and Analysis Tools. Kate Milova cDNA Microarray Facility March 24, 2005.

Asteraceae (Compositae) Genome Resources at NCBI GenBank.

Kate Milova MolGen retreat March 24, Microarray experiments. Database and Analysis Tools. Kate Milova cDNA Microarray Facility March 24, 2005.

Discovery of new biomarkers as indicators of watershed health and water quality Anamaria Crisan & Mike Peabody.

H = -Σp i log 2 p i. SCOPI Each one of the many microbial communities has its own structure and ecosystem, depending on the body environment it exists.

BLAST benchmarks George Coulouris NCBI/NLM/NIH June 2005.

Blast 1. Blast 2 Low Complexity masking >GDB1_WHEAT MKTFLVFALIAVVATSAIAQMETSCISGLERPWQQQPLPPQQSFSQQPPFSQQQQQPLPQ QPSFSQQQPPFSQQQPILSQQPPFSQQQQPVLPQQSPFSQQQQLVLPPQQQQQQLVQQQI.

Workshop OUTLINE Part 1: Introduction and motivation How does BLAST work? Part 2: BLAST programs Sequence databases Work Steps Extract and analyze results.

Searching Molecular Databases with BLAST. Basic Local Alignment Search Tool How BLAST works Interpreting search results The NCBI Web BLAST interface Demonstration.

1 P6a Extra Discussion Slides Part 1. 2 Section A.

NCBI resources II: web-based tools and ftp resources Yanbin Yin Fall 2014 Most materials are downloaded from ftp://ftp.ncbi.nih.gov/pub/education/ 1.

K Phone: Web: A Software Package for the Design and Analysis of Microbial Functional.

Biological databases Exercises. Discovery of distinct sequence databases using ensembl.

Basic Local Alignment Search Tool BLAST Why Use BLAST?

1 Improve Protein Disorder Prediction Using Homology Instructor: Dr. Slobodan Vucetic Student: Kang Peng.

Pairwise Sequence Alignment Part 2. Outline Summary Local and Global alignments FASTA and BLAST algorithms Evaluating significance of alignments Alignment.

David Wishart February 18th, 2004 Lecture 3 BLAST (c) 2004 CGDN.

What is BLAST? Basic BLAST search What is BLAST?

Work Presentation Novel RNA genes in A. thaliana Gaurav Moghe Oct, 2008-Nov, 2008.

Research Paper on BioInformatics

Scoring Sequence Alignments Calculating E

A Practical Guide to NCBI BLAST

New BioCyc Search Tools Suzanne Paley Pathway Tools Workshop 2018

Nat. Rev. Gastroenterol. Hepatol. doi: /nrgastro

Gene Annotation with DNA Subway

H = -Σpi log2 pi.

Taxonomic composition of subway microbial communities.

Identify D. melanogaster ortholog

Cooccurrence network for dolphin rectum microbiome.

Heatmap displaying consistent similarity-based OTU results based on SIMPER intragroup similarity analyses for the tissue, mucus, holobiont, and seawater.

The dicBF locus is conserved in E. coli species in different prophages

Benchmarks of OTU picking tools on natural communities.

Basic Local Alignment Search Tool

Rampant Host Switching Shaped the Termite Gut Microbiome

Fractions of 16S rRNA genes from bacteria (top panel) and archaea (bottom panel) in public databases from primer-amplified metagenomes (with and without.

(a) PCoA of the abundance of unique OTUs per sample from the 16S marker gene sequencing data from the AGP data repository (small spheres) and the San Diego.

Dissemination of the mcr-1 colistin resistance gene

Rank abundance plots by taxonomic genus assignments for metagenomic data (top three rows) and metatranscriptomic data (bottom two rows). Rank abundance.

Putative MBTA microbial community sources.

Plots of the number of sequences [log (x + 1) scale] from bacterial OTUs in both PCR replicates (PCR1 and PCR2) of the 348 wild rodents analyzed in the.

(a) Correspondence analysis of 88 soil samples.

Bacteroidetes bacteria are the main contributors to LPS biosynthesis in the human gut microbiome. Bacteroidetes bacteria are the main contributors to LPS.

OTU and beta-diversity novelty.

Example usage of mockrobiota MC resource for marker gene and metagenome sequencing pipelines. Example usage of mockrobiota MC resource for marker gene.

Stability of fecal microbiomes in different preservatives and under different temperature treatments. Stability of fecal microbiomes in different preservatives.

Example of amplicon performance in our presented workflow.

Workflow of the wet laboratory, bioinformatics, and data filtering procedures in the process of data filtering for 16S rRNA amplicon sequencing. Workflow.

Proportion of 16S rRNA gene sequences in each category of phylogenetic novelty relative to cultures for each environment, by amplicons, metagenomes (without.

The others: our biased perspective of eukaryotic genomes

Functional potential analyses.

Belowground microbiome community responses.

Sequence alignment, E-value & Extreme value distribution

(A) Amphibian SourceTracker analysis reveals that water is the only sample type that obtains a notable amount of its microbial community from amphibian.

Phylogenetic novelty observed in the Alert, NU, Illumina library (42) showing (a) the recovery of unique lineages (UL) observed in a manual survey for.

Environment Strategy for East Sussex:

Heatmap showing Spearman’s rho values for significant correlations between weed abundances and bacterial classes (i.e., OTU data pooled at the class level;

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

Variations in beta and alpha diversity of gut microbiome bacterial communities in relation to presence of Blastocystis. Variations in beta and alpha diversity.

Variations in beta and alpha diversity of gut microbiome eukaryotic communities explained by presence of Blastocystis. Variations in beta and alpha diversity.

Dynamic Bayesian inference network.

Comparison of 16S sequencing and shallow shotgun recovery of species-level taxa. Comparison of 16S sequencing and shallow shotgun recovery of species-level.

Presentation transcript:

Sequence novelty among SSUnique pipeline-filtered OTUs (unclassified at the class level) in the Earth Microbiome Project (EMP) and Human Microbiome Project (HMP) data, identified by BLASTn search of a 10% random subset against nonredundant NCBI GenBank (excluding environmental and uncultured sequences). Sequence novelty among SSUnique pipeline-filtered OTUs (unclassified at the class level) in the Earth Microbiome Project (EMP) and Human Microbiome Project (HMP) data, identified by BLASTn search of a 10% random subset against nonredundant NCBI GenBank (excluding environmental and uncultured sequences). Asterisks correspond to mean sequence BLASTn identity. Michael D. J. Lynch, and Josh D. Neufeld mSystems 2016; doi:10.1128/mSystems.00133-16