Amino acid sequence deduced from the sequence of contig 131 of G

Slides:

Advertisements

Similar presentations

Common Errors in Student Annotation Submissions contributions from Paul Lee, David Xiong, Thomas Quisenberry Annotating multiple genes at the same locus.

Advertisements

MVKFLFSVIILFFLLSAVGSSARNIEEDGVIRLPSEVKDFINGKNIDDDSVGGTRWAVLI 60 AGSSGYWNYRHQADVCHAYQVLKRGGVKDENIVVFMYDDIALNEENPRPGVIINHPKGED 120 VYAGVPKDYTGRDVTAHNFYSVLLGNKTAVKGGSGKVIDSGPNDHIFIYYSDHGGPGVLG.

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

Supporting Fig. S1 OsRHR-GFP GFP ChlorophyllMerge GC Hoechst Merge GH Supporting Figure S1. The OsPHR-GFP fusion protein localizes to nuclei, chloroplasts,

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Volume 88, Issue 5, Pages (March 1997)

Fig. 1. (A) The nucleotide and deduced amino acid sequences of the vacuolar serine protease protein of F. proliferatum (Fus p , GenBank accession.

Sequence and comparison of the SDS protein.

Rethinking ALS: The FUS about TDP-43

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

(A) NK cell cytotoxicity assays against K562, H9, and Raji target cell lines in the presence (black) and absence (white) of an anti-NKp30 antibody, clone.

Multiple sequence alignment and analysis of SOFL proteins.

Characterization of Siglec-5, a Novel Glycoprotein Expressed on Myeloid Cells Related to CD33 by Ann L. Cornish, Sylvie Freeman, Gareth Forbes, Jian Ni,

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

(A) Schematic representation of kalata B1 showing the cyclic cystine knot, the amino acid sequence in single letter code, and the regions used for oligonucleotide.

by Parisa Asvadi, Zohra Ahmadi, and Beng H. Chong

Identify D. melanogaster ortholog

Prediction of protein structure

Fig. 3. Structure of ALS-associated RNA binding proteins.

LMU Department of Biology

The 130-bp key region of the promoter of TsVP1 is a direct binding target of TsNAC1. The 130-bp key region of the promoter of TsVP1 is a direct binding.

Phosphopeptides identified harboring minimal binding motifs

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

Volume 88, Issue 5, Pages (March 1997)

Prion-like Domains Program Ewing’s Sarcoma

Figure 1: The full-length cDNA and deduced amino acid sequences of Lysozyme C and amino acid sequences from rock bream, Oplegnathus fasciatus. The primers.

STAT Genes Found in C. elegans

Clustering of Activating Mutations in c-KIT’s Juxtamembrane Coding Region in Canine Mast Cell Neoplasms Yongsheng Ma, B. Jack Longley, Xiaomei Wang

Where would you draw the polyA tail in the gene above?______________

Volume 10, Issue 14, Pages R512-R513 (July 2000)

Chromatin: Ga-ga over GAGA factor

Fig. 1 A single amino acid difference in the ATP-binding domain of GSK3α and GSK3β results in structural and topological differences. A single amino acid.

Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Protein sequence alignments for the BcfD (A) and StfH (B) allelic.

Volume 6, Issue 1, Pages (July 2000)

Cell Signalling: Receptor orphans find a family

Tertiary Structure of Destrin and Structural Similarity between Two Actin-Regulating Protein Families H Hatanaka, K Ogura, K Moriyama, S Ichikawa, I.

Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development K. Kosaki,

Mutations in Cohesin Complex Members SMC3 and SMC1A Cause a Mild Variant of Cornelia de Lange Syndrome with Predominant Mental Retardation Matthew A.

iraL shares sequence identity with iraM from E

Identification of the GCS1 ortholog in Gonium pectorale.

AKAP15 coimmunoprecipitates with CaV1

Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.

Figure 1 Pedigree and genetic findings

The family of bone morphogenetic proteins

Fig. 4. transparent encodes Mpv17.(A) tra maps to chromosome 20.

(A) Deduced amino acid sequence of the D2SV cDNA cloned from the mouse heart RNA. The novel 20 amino acid C-terminus (CT) is underlined. (A) Deduced amino.

An alignment of vertebrate preproendothelin-1 protein sequences.

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Fig. 4. The predicted protein domains in sma

Schematic representation of the domain structures of insect enzymes involved in chitin metabolism. Schematic representation of the domain structures of.

Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Structure of PrfA (A) and its target DNA sequences in PrfA-regulated promoters (B). Structure of PrfA (A) and its target DNA sequences in PrfA-regulated.

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Volume 10, Issue 5, Pages (May 2002)

Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins. Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins.

Phosphopeptides identified harboring minimal binding motifs

Comparison of the sequences of Fzo/Mfn and structure of mammalian Mfn2

Phylogenetic analysis of AquK2P.

Alignment of the deduced amino acid sequence of rat olfactory CNCβ1b with bovine rod CNCβ1a. Alignment of the deduced amino acid sequence of rat olfactory.

Selectivity-determining regions

Effects of a human FABP7 point mutation on FABP7 protein structure

M L L L V L L V V L I L L I V R R Predicted transmembrane domain

Primary structure of zebra finch CREB

Structural features of seven streptococcal cell surface proteins that function in adherence and colonization. Structural features of seven streptococcal.

Dot plot comparison of EBNA-1 with recombinant antigens 52/3 (aa 297 to 433 of pUL44) and UL57/3 (aa 545 to 601 of pUL57) of HCMV, containing glycine-rich.

Multiple alignment of type I and III IFNs from Xenopus, chicken, and human. Multiple alignment of type I and III IFNs from Xenopus, chicken, and human.

Sequence alignment of colicin lysis proteins.

Amino acid sequence of antigenic fragments 52/3 and UL57/3 of pUL44 and pUL57, respectively, and sequence comparison by dot plot analysis. Amino acid sequence.

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

Amino acid sequence deduced from the sequence of contig 131 of G Amino acid sequence deduced from the sequence of contig 131 of G. natalis aligned with the two most similar sequences identified by BLASTX analysis: DROME Mlp84B Drosophila melanogaster muscle LIM protein (gil2497676; splQ24400), DROME Mlp60A D. melanogaster muscle LIM protein (gil 1709057; spl P53777); and three most closely related human proteins: HUMAN MLPCSRP3 human muscle LIM protein (gil1705933; spl P50461.1), HUMAN CSRP2 cysteine- and glycine-rich protein-2 (gil 2497674; spl Q16527) and HUMAN CSRP1 cysteine- and glycine-rich protein-1 (gil 118161; spl P21291). Amino acid sequence deduced from the sequence of contig 131 of G. natalis aligned with the two most similar sequences identified by BLASTX analysis: DROME Mlp84B Drosophila melanogaster muscle LIM protein (gil2497676; splQ24400), DROME Mlp60A D. melanogaster muscle LIM protein (gil 1709057; spl P53777); and three most closely related human proteins: HUMAN MLPCSRP3 human muscle LIM protein (gil1705933; spl P50461.1), HUMAN CSRP2 cysteine- and glycine-rich protein-2 (gil 2497674; spl Q16527) and HUMAN CSRP1 cysteine- and glycine-rich protein-1 (gil 118161; spl P21291). CCHC and CCCC zinc-binding sites of the LIM domain are italicised and underlined, the glycine residues that comprise the glycine-rich region following the LIM domain are shaded in black and the potential nuclear targeting signal is bold and underlined. Ute Postel et al. J Exp Biol 2010;213:1740-1750 © 2010.