Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

Slides:

Advertisements

Similar presentations

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Advertisements

Envelope generated by the interaction of the EODs of three weakly electric fish. Envelope generated by the interaction of the EODs of three weakly electric.

Midbrain electrosensory neurons respond to envelopes.

inhibits BMP signalling.

Multiple sequence alignment of S

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

Characterization of Siglec-5, a Novel Glycoprotein Expressed on Myeloid Cells Related to CD33 by Ann L. Cornish, Sylvie Freeman, Gareth Forbes, Jian Ni,

by Parisa Asvadi, Zohra Ahmadi, and Beng H. Chong

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

CNNM2, Encoding a Basolateral Protein Required for Renal Mg2+ Handling, Is Mutated in Dominant Hypomagnesemia Marchel Stuiver, Sergio Lainez, Constanze.

Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Protein sequence alignments for the BcfD (A) and StfH (B) allelic.

Identification of the GCS1 ortholog in Gonium pectorale.

AKAP15 coimmunoprecipitates with CaV1

Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.

Evaluation of LC3 and ATG13 dynamics in AS-stimulated microglial cells using live-imaging. Evaluation of LC3 and ATG13 dynamics in AS-stimulated microglial.

SNARE motif sequence alignment of GOSR2 and its yeast ortholog, Bos1.

Fig. 4. transparent encodes Mpv17.(A) tra maps to chromosome 20.

A highly conserved six-amino-acid region in the C-terminal CT domain of MARCH8 is responsible for its ability to downregulate TfR. A highly conserved six-amino-acid.

The distribution of lamin C and emerin in lymphoblastoid cell lines.

The C-terminal membrane-proximal region of MARCH8 interacts with TfR.

The effects of a dominant negative mutant of lamin B1 on lamin distribution in HeLa cells. The effects of a dominant negative mutant of lamin B1 on lamin.

Positive relationship between the residual breaking force and cuticle area of lamellar joints. Positive relationship between the residual breaking force.

Fig. 4. Expression of p75NTR and time-course of TrkA autophosphorylation at the Y751 and Y490 sites in PC12-27 cells transfected with the vector, empty.

PfSec13 is a structural homolog of ScSec13·Nup145C.

Proteins associated with PfSec13.

Timing of homeward flights of bees after the second release.

(A) Deduced amino acid sequence of the D2SV cDNA cloned from the mouse heart RNA. The novel 20 amino acid C-terminus (CT) is underlined. (A) Deduced amino.

ICAM-1 forms distinct complexes with filamin B, α-actinin-4 and cortactin. ICAM-1 forms distinct complexes with filamin B, α-actinin-4 and cortactin. (A)

Fig. 7. Representative images of control (Cas9+GFP) and Cas9+gRNA+GFP co-injected embryos on day 4 of culture, showing nuclear-imported GFP (green) and.

Fig. 7. Ror-GFP binds to Myc-tagged Wnts and Wnt receptors.

The interaction of gecko toe pads with the substrate in the presence and absence of water. The interaction of gecko toe pads with the substrate in the.

An alignment of vertebrate preproendothelin-1 protein sequences.

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Schematic representation of the domain structures of insect enzymes involved in chitin metabolism. Schematic representation of the domain structures of.

An inhibitor of HSP90β reduces the level of HNF4A protein in hepatic progenitor cells. An inhibitor of HSP90β reduces the level of HNF4A protein in hepatic.

Alignment of the fast/developmental and IIM MYH genes.

Overview of HEAT-motif-containing proteins.

Z-stack compressions showing triple labelling of different cell types in the gills of bowfin with serotonin antibody (5-HT, green) and the neuronal marker.

Crim1 colocalizes with integrin and activates the integrin-FAK-ERK signaling pathway. Crim1 colocalizes with integrin and activates the integrin-FAK-ERK.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

14-3-3γ phosphorylated at S59 by Lats2 in response to UV damage.

Fig. 2. RGD and KGD motifs in N. vectensis thrombospondins

(A) Segregation of mutations in TMEM231 in JBTS families.

Z-stack compressions showing triple labelling of different cell types in the gills of bowfin with antibodies for serotonin (5-HT, green) and HNK-1 (magenta),

Identification of a functional domain in MKL1_S that allows specific transcriptional activity. Identification of a functional domain in MKL1_S that allows.

Vertical ground reaction force–time waveforms for RFS trials.

Vertical ground reaction force–time waveforms for FFS trials.

Lysine residues in the cytoplasmic region of TfR are involved in the MARCH8-induced downregulation of TfR. Lysine residues in the cytoplasmic region of.

Streaming phenotypes are developmentally regulated.

Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins. Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins.

RAD51 interacts with SUMO-1 through its SIM

The occurrence of D calls on a dive profile.

A broken-stick O2-uptake function for male and female killer whales as used in the O2 model (model 3). A broken-stick O2-uptake function for male and female.

Fig. 2. Acetylation stiffens primary cilia.

Comparison of the sequences of Fzo/Mfn and structure of mammalian Mfn2

Conservation of key sequence features and endocytic localisation in TbCALM. Conservation of key sequence features and endocytic localisation in TbCALM.

Alignment of the deduced amino acid sequence of rat olfactory CNCβ1b with bovine rod CNCβ1a. Alignment of the deduced amino acid sequence of rat olfactory.

Two REMS-like iterations demonstrating common patterns of rapid brightness changes of skin patterning. Two REMS-like iterations demonstrating common patterns.

Characterization of the ERα-UBS.

Vps36 interacts with Smo in the absence of Hh

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

Structural insights based on chimeric Alp4-GCP2 analysis.

Example of swimming trajectories from three groups of fish from three different weeks along with the extracted behavioral parameters. Example of swimming.

The vertical ground reaction force–time waveforms generated by the model for FFS trials with varied m1 values. The vertical ground reaction force–time.

Figure 2 Compound heterozygous mutations in ADAM22

DAPK interacts with HSF1 in vivo and in vitro.

Phylogenetic analysis and domain structure of CALM proteins.

Predicted Amino Acid Sequence of the Tomato Cf-4 Protein (Thomas et al

A, Schematic diagram of identified splice variants of PD-L1.

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

Mosquito GluCl alignment and anti-AgGluCl IgG specificity. Mosquito GluCl alignment and anti-AgGluCl IgG specificity. (A) ClustalW alignment of predicted amino acid sequences for the glutamate-gated chloride channels AgGluCl-b (AGAP001434) from Anophelesgambiae and AaGluCl (AAEL003003) from Aedesaegypti. Black bars denote transmembrane domains, asterisks indicate identical residues, and colons and full-stops indicate conservation between groups of strongly and weakly similar properties, respectively. (B) Western blot of anti-AgGluCl IgG against the AgGluCl extracellular domain. (C) C6/36 cells transfected with AgGluCl and eGFP (green). Cells were immunostained for anti-AgGluCl IgG (pink) and DAPI (blue) (Habluetzel et al., 1997). Jacob I. Meyers et al. J Exp Biol 2015;218:1487-1495 © 2015. Published by The Company of Biologists Ltd