Nucleotide alignment of 3′ untranslated region (UTR) for four crustacean Rheb genes. Nucleotide alignment of 3′ untranslated region (UTR) for four crustacean.

Slides:

Advertisements

Similar presentations

1 Computational Molecular Biology MPI for Molecular Genetics DNA sequence analysis Gene prediction Gene prediction methods Gene indices Mapping cDNA on.

Advertisements

Finding Eukaryotic Open reading frames.

Common Errors in Student Annotation Submissions contributions from Paul Lee, David Xiong, Thomas Quisenberry Annotating multiple genes at the same locus.

Mutation And Natural Selection how genomes record a history of mutations and their effects on survival Tina Hubler, Ph.D., University of North Alabama,

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

Fea- ture Num- ber Feature NameFeature description 1 Average number of exons Average number of exons in the transcripts of a gene where indel is located.

Transcription and Translation: Part 1 of 3: RNA Tsonwin Hai, Ph.D. Professor Department of Molecular and Cellular Biochemistry The Ohio State University.

Eukaryotic Gene Structure. 2 Terminology Genome – entire genetic material of an individual Transcriptome – set of transcribed sequences Proteome – set.

Finding genes in the genome

FIGURE deoxyadenosine-5-triphosphate.. FIGURE 4.2. The four bases found in DNA.

Genetic Code and Interrupted Gene Chapter 4. Genetic Code and Interrupted Gene Aala A. Abulfaraj.

Figure 1. Schematic of the corA leader mRNA

C acaatataATGGAGCGTGAGACTTCGTCATCTTCAACTCCTCCGGAGGATCTTGTTACATCGATGATCGGAAAGTTCGTCGCTGTCATGTCTA b acaatataATGGAGCGTGAGACTTCGTCATCTTCAACTCCTCCGGAGGATCTTGTTACATCGATGATCGGAAAGTTCGTCGCTGTCTTGTCTA.

Eukaryotic Gene Structure

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

22 kDa a-coixin gene cluster

Quiz#3 LC710 9/29/10 name____________

Vienna RNA web servers

The Cap-Binding Translation Initiation Factor, eIF4E, Binds a Pseudoknot in a Viral Cap- Independent Translation Element Zhaohui Wang, Marc Parisien,

CYB561 mutations. CYB561 mutations. The upper part shows the structure of the CYB561 gene, with the positions of the identified mutations indicated. Gray.

A Unique Type I Keratin Intermediate Filament Gene Family is Abundantly Expressed in the Inner Root Sheaths of Sheep and Human Hair Follicles C. Simon.

Small RNA and Cyanobacteria

Mark M Metzstein, H.Robert Horvitz Molecular Cell

LINEs Mobilize SINEs in the Eel through a Shared 3′ Sequence

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

Structure of in‐frame deletions.

Christopher M. Watson, Nick Camm, Laura A

Base-Pairing between Untranslated Regions Facilitates Translation of Uncapped, Nonpolyadenylated Viral RNA Liang Guo, Edwards M. Allen, W.Allen Miller

Protein Synthesis Step 2: Translation

Conserved Seed Pairing, Often Flanked by Adenosines, Indicates that Thousands of Human Genes are MicroRNA Targets Benjamin P. Lewis, Christopher B. Burge,

The Cap-Binding Translation Initiation Factor, eIF4E, Binds a Pseudoknot in a Viral Cap- Independent Translation Element Zhaohui Wang, Marc Parisien,

The dicBF locus is conserved in E. coli species in different prophages

mRNA Degradation and Translation Control

Volume 84, Issue 3, Pages (February 1996)

A Novel Mouse Gene, Sh3yl1, is Expressed in the Anagen Hair Follicle

Volume 113, Issue 5, Pages (May 2003)

Volume 117, Issue 3, Pages (September 1999)

Volume 64, Issue 4, Pages (October 2003)

Volume 154, Issue 1, Pages (July 2013)

Size Polymorphisms in the Human Ultrahigh Sulfur Hair Keratin-Associated Protein 4, KAP4, Gene Family Naoyuki Kariya, Yutaka Shimomura, Masaaki Ito

Figure 1: The full-length cDNA and deduced amino acid sequences of Lysozyme C and amino acid sequences from rock bream, Oplegnathus fasciatus. The primers.

Antigenic Variation in Malaria

Schematic diagrams of genomic structure, the strategy for genomic cDNA cloning, and molecular characterization of unique features of three emergent U.S.

Volume 14, Issue 7, Pages (February 2016)

Reading Frames and ORF’s

The Divergent U12-Type Spliceosome Is Required for Pre-mRNA Splicing and Is Essential for Development in Drosophila Leo R. Otake, Petra Scamborova, Carl.

Volume 21, Issue 6, Pages (June 2013)

Possible secondary structure of the S. enterica prs leader.

Histidine kinases are expanded in the fusaria.

Complete Haplotype Sequence of the Human Immunoglobulin Heavy-Chain Variable, Diversity, and Joining Genes and Characterization of Allelic and Copy-Number.

Evolutionary History of the ADRB2 Gene in Humans

iraL shares sequence identity with iraM from E

Identification of the GCS1 ortholog in Gonium pectorale.

Gene Structure.

Shifty Ciliates Lawrence A. Klobutcher, Philip J. Farabaugh Cell

PfSec13 is a structural homolog of ScSec13·Nup145C.

Schematic representation of the domain structures of insect enzymes involved in chitin metabolism. Schematic representation of the domain structures of.

Alignment of the fast/developmental and IIM MYH genes.

Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

Common Errors in Student Annotation Submissions contributions from Paul Lee, David Xiong, Thomas Quisenberry Annotating multiple genes at the same locus.

Jingwei Ni, Amy L Tien, Maurille J Fournier Cell

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins. Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins.

Sequence variation of 16S rRNA gene primer-binding sites.

Instances during the time course of wake generation behind a steadily swimming eel (speed U=0.121 m s-1, sequence 1, see Table 1). Instances during the.

Identification of an unusual translation start in the published human MKL1. Identification of an unusual translation start in the published human MKL1.

Mutation of the Ca2+ Channel β Subunit Gene Cchb4 Is Associated with Ataxia and Seizures in the Lethargic (lh) Mouse Daniel L Burgess, Julie M Jones,

Nucleotide and predicted amino acid sequence of the adult mouse brain cdr2 cDNA. Nucleotide and predicted amino acid sequence of the adult mouse brain.

A, Schematic diagram of identified splice variants of PD-L1.

Gene Structure.

Presentation transcript:

Nucleotide alignment of 3′ untranslated region (UTR) for four crustacean Rheb genes. Nucleotide alignment of 3′ untranslated region (UTR) for four crustacean Rheb genes. Abbreviations: green crab, Carcinus maenas [Cm, complete, 872 nucleotides (nt)]; green mud crab, S. paramamosain (Sp, partial 3′ UTR, 81 nt); blackback land crab, Gecarcinus lateralis (Gl, partial 3′ UTR, 248 nt); and American lobster, Homarus americanus (Ha, complete, 883 nt). Identities among at least two sequences are indicated with black shading. Dashes indicate gaps introduced to optimize the alignment, but gaps at the ends of sequences were removed for clarity. All sequences begin immediately 3′ of the stop codon. Conserved K-box (minimal consensus TGTGAT) and poly A signal (AATAAA) sequences are labeled. The portion of the alignment between the @ symbols indicates the portion of the RNA (160–280 of Cm-Rheb) predicted by RNAz (Gruber et al., 2007) to form secondary structure consistent with coding mRNA. ORF, open reading frame. Kyle S. MacLea et al. J Exp Biol 2012;215:590-604 © 2012.