Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Slides:

Advertisements

Similar presentations

Comparison of p53 Structure: Wild type vs. mutant What change in wild type p53 may lead to cancer?

Advertisements

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Fig. 1. (A) The nucleotide and deduced amino acid sequences of the vacuolar serine protease protein of F. proliferatum (Fus p , GenBank accession.

Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,

Sequence and comparison of the SDS protein.

Multiple sequence alignment of S

Multiple sequence alignment and analysis of SOFL proteins.

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

Phosphopeptides identified harboring minimal binding motifs

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

STAT Genes Found in C. elegans

Where would you draw the polyA tail in the gene above?______________

Sequence alignment of PHCCEx domains with secondary structure elements of the Tiam2 PHCCEx domain at the top. Sequence alignment of PHCCEx domains with.

Fig. 1 A single amino acid difference in the ATP-binding domain of GSK3α and GSK3β results in structural and topological differences. A single amino acid.

Identification of the GCS1 ortholog in Gonium pectorale.

AKAP15 coimmunoprecipitates with CaV1

Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.

The family of bone morphogenetic proteins

Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.

SNARE motif sequence alignment of GOSR2 and its yeast ortholog, Bos1.

Total glutathione [2 oxidised (GSSG) + reduced (GSH); A] and reduced glutathione (B) concentration in smaller [A0–A4, open circles; shell height 50.45±4.04.

Positive relationship between the residual breaking force and cuticle area of lamellar joints. Positive relationship between the residual breaking force.

Volume 2, Issue 1, Pages 1-4 (January 1994)

PfSec13 is a structural homolog of ScSec13·Nup145C.

Proteins associated with PfSec13.

(A) Deduced amino acid sequence of the D2SV cDNA cloned from the mouse heart RNA. The novel 20 amino acid C-terminus (CT) is underlined. (A) Deduced amino.

24 h mean of body temperature plotted against 24 h mean of air temperature (A), and 24 h amplitude of body temperature plotted against 24 h range of air.

Fig. 7. Interaction between BAF60c and cardiac transcription factors.

Fig. 1. Fusion protein amino acid sequences. Chick CaV2

Performance of Drosophila on diet supplemented with B vitamins.

Fig. 7. Ror-GFP binds to Myc-tagged Wnts and Wnt receptors.

An alignment of vertebrate preproendothelin-1 protein sequences.

Amino acid sequence deduced from the sequence of contig 131 of G

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Fig. 4. The predicted protein domains in sma

Schematic representation of the domain structures of insect enzymes involved in chitin metabolism. Schematic representation of the domain structures of.

The Bov-A2 element is conserved in the NOS2 gene of bovid species.

Alignment of the fast/developmental and IIM MYH genes.

Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

(A) Subvertebral sac pressure and brachial sac pressure during a breathing sequence in one C. marinus. (A) Subvertebral sac pressure and brachial sac pressure.

Cardiac sarcoplasmic reticulum vesicles from winter-hibernating ground squirrels exhibit faster Ca2+ uptake than those from autumn, non-hibernating individuals.

Female responses to two-monitor control playbacks.

Identification of a functional domain in MKL1_S that allows specific transcriptional activity. Identification of a functional domain in MKL1_S that allows.

Structure of PrfA (A) and its target DNA sequences in PrfA-regulated promoters (B). Structure of PrfA (A) and its target DNA sequences in PrfA-regulated.

Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins. Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins.

RAD51 interacts with SUMO-1 through its SIM

Gel-filtration chromatography of the active fractions from the Mono-Q column marked by the horizontal bar in Fig. 1. Gel-filtration chromatography of the.

Phosphopeptides identified harboring minimal binding motifs

Effects of arginine vasotocin (AVT) on the production of type-II chirps by a single male. Effects of arginine vasotocin (AVT) on the production of type-II.

Effects of arginine vasotocin (AVT) on the production of type-I chirps by a single male. Effects of arginine vasotocin (AVT) on the production of type-I.

Comparison of the sequences of Fzo/Mfn and structure of mammalian Mfn2

Conservation of key sequence features and endocytic localisation in TbCALM. Conservation of key sequence features and endocytic localisation in TbCALM.

Phylogenetic analysis of AquK2P.

Alignment of the deduced amino acid sequence of rat olfactory CNCβ1b with bovine rod CNCβ1a. Alignment of the deduced amino acid sequence of rat olfactory.

Ub-binding ability of ERα.

Two REMS-like iterations demonstrating common patterns of rapid brightness changes of skin patterning. Two REMS-like iterations demonstrating common patterns.

Structural insights based on chimeric Alp4-GCP2 analysis.

Figure 2 Compound heterozygous mutations in ADAM22

Phylogenetic analysis and domain structure of CALM proteins.

Selectivity-determining regions

Hymenoptera venom protease allergens

Journal: Scientia Horticulturae

Predicted pathogenic BRCA1 amino acid substitutions are confined to the evolutionarily conserved N- and C-terminal domains. Predicted pathogenic BRCA1.

S. moellendorffii BBI3 Is Predicted to Be a BBI Based on Sequence Similarity at the Inhibitory Motifs and Shared Primary Protein Architecture. S. moellendorffii.

Multiple alignment of type I and III IFNs from Xenopus, chicken, and human. Multiple alignment of type I and III IFNs from Xenopus, chicken, and human.

Amino acid sequence similarity among C

Sequence alignment of colicin lysis proteins.

Residues 327 and 404 are key binding sites for GII. 4F MAb

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. The Ca2+-binding domain is indicated in bold type. Conserved residues are marked by an asterisk; conservative differences are marked by a full point. Sources, references and accession numbers are described in Materials and methods. Katerina A. Moutou et al. J Exp Biol 2001;204:3009-3018 © The Company of Biologists Limited 2001