Molecular characterization of VAB

Slides:

Advertisements

Similar presentations

Supporting Fig. S1 OsRHR-GFP GFP ChlorophyllMerge GC Hoechst Merge GH Supporting Figure S1. The OsPHR-GFP fusion protein localizes to nuclei, chloroplasts,

Advertisements

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Positive Negative Tanz et al. Supp Fig. 1 unassigned st r . . & env.

Schematic representation of p53 molecule

Identification and characterization of a xap5 mutant in Chlamydomonas.

Pericentrosomal Localization of the TIG3 Tumor Suppressor Requires an N-Terminal Hydrophilic Region Motif Tiffany M. Scharadin, Gautam Adhikary, Kristin.

Phosphorylation and sequence disorder in microtubule-associated protein Tau.A, schematic illustration of the domain profile of Tau with all known phosphorylation.

A New Dimension for Low-Dimensional Carbon Nanostructures

Proposed reaction sequence initiating HMBPP reduction as it was derived from crystallographic data. Proposed reaction sequence initiating HMBPP reduction.

FUS Zigzags Its Way to Cross Beta

The evolutionary conserved cassette ABBA1-KEN2-ABBA2 in BUBR1 is essential for SAC signalling. The evolutionary conserved cassette ABBA1-KEN2-ABBA2 in.

(A) Schematic representation of kalata B1 showing the cyclic cystine knot, the amino acid sequence in single letter code, and the regions used for oligonucleotide.

HIS-24K14me1 interacts with HPL-1.

TIE2hi/VEGFAhi TEMs are present in the TMEM

Volume 5, Issue 1, Pages (January 2012)

The Bacterial Cytoskeleton

Volume 8, Issue 10, Pages (October 2015)

Toward a Molecular Structure of the Eukaryotic Kinetochore

MOSPD2 is a putative tail‐anchored protein

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

Volume 9, Issue 5, Pages (May 2016)

Selection and Identification of Skeletal-Muscle-Targeted RNA Aptamers

Takashi Murayama, Jun Takayama, Mayuki Fujiwara, Ichiro N. Maruyama

Both AtSYP121-Sp2 and ZmSYP121-Sp2 Fragments Selectively Reduce the Accumulation of Zm-PIP2;5 in the Plasma Membrane of Maize Mesophyll Protoplasts.(A)

Volume 10, Issue 2, Pages (February 2017)

Figure 1 T-cell receptor 2D1 recognizes human leukocyte antigen (HLA)–A2–restricted octameric and nonameric synthetic peptides T-cell receptor 2D1 recognizes.

Jiawen Huang, Hongyan Wang Stem Cell Reports

Volume 9, Issue 7, Pages (July 2016)

Volume 7, Issue 2, Pages (February 2014)

Volume 26, Issue 3, Pages (May 2007)

Crystal Structures of the BAR-PH and PTB Domains of Human APPL1

Volume 19, Issue 12, Pages (June 2017)

Arabidopsis WRKY45 Interacts with the DELLA Protein RGL1 to Positively Regulate Age-Triggered Leaf Senescence Ligang Chen, Shengyuan Xiang, Yanli Chen,

The Subcellular Distribution of a Sar1-YFP Fusion Is Altered by the Expression of Golgi Markers.(A) and (B) Cytoplasm of a tobacco leaf epidermal cell.

Up-regulation of BDNF induces the neurite outgrowth of SH-SY5Y cells.

Aggregation is not required for cytoplasmic relocalization induced by misfolding mutations. Aggregation is not required for cytoplasmic relocalization.

A highly conserved six-amino-acid region in the C-terminal CT domain of MARCH8 is responsible for its ability to downregulate TfR. A highly conserved six-amino-acid.

The distribution of lamin C and emerin in lymphoblastoid cell lines.

Patterns of cell movement in paraxial mesoderm.

(A–E) Distribution of BCECF and TMRE fluorescence in a double-labelled isolated salivary gland. (A–E) Distribution of BCECF and TMRE fluorescence in a.

Volume 10, Issue 9, Pages (September 2017)

Pax2a and Pax8 are required for induction of otic cell fates.

(A) Faucher and Pliska hydrophobicity plot of D2SV protein sequence.

(A) Deduced amino acid sequence of the D2SV cDNA cloned from the mouse heart RNA. The novel 20 amino acid C-terminus (CT) is underlined. (A) Deduced amino.

Fig. 7. Interaction between BAF60c and cardiac transcription factors.

Amino acid sequence deduced from the sequence of contig 131 of G

Figure 1 Schematic representation of FOXG1 gene, protein domain structure, and positions of FOXG1 mutations Schematic representation of FOXG1 gene, protein.

EpiDEG efficiently degrades GFP-tagged proteins that localize to different subcellular localizations. epiDEG efficiently degrades GFP-tagged proteins that.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Fig. 3 BIC1 and BIC2 inhibit early photoreactions of cryptochromes.

Immunofluorescence analysis of GpGCS1 localization in strains K41 (mating-type plus) and K34 (mating-type minus). Immunofluorescence analysis of GpGCS1.

Volume 30, Issue 3, Pages (May 2008)

Subcellular localization of VAN3.

Fig. 5. Co-expression analyses of disease mutations in YFP-RPGRIP1α1 with wild-type RFP-RPGR1–19 or RFP-RPGRORF15 in COS7 cells.YFP-RPGRIP1α1 with disease-associated.

The regulatory domain of HSF1 is involved in the pro-apoptotic response to TNF. (A) Upper panel, functional domains and potential DAPK phosphorylation.

Fig. 7. Analysis of dFMRP kinetics in dFMRP granules by FRAP

Phylogenetic analysis of AquK2P.

ITS rRNA gene locus. ITS rRNA gene locus. Schematic of the eukaryotic ribosomal gene cluster. The SILVA database contains sequences of the 18S gene, while.

WW domain of Rsp5p blocks TBSV RNA replication in yeast.

A, structure of the deduced polypeptides coded by MAGE-E1 mRNAs.

Cell Sorting of Induced SE-like Cells Using SEOR1pro:SEOR1-YFP.

Pleckstrin Homology Domains: Two Halves Make a Hole?

In Vivo Interaction Between AtPIP2;1 and GRFs

Dot plot comparison of EBNA-1 with recombinant antigens 52/3 (aa 297 to 433 of pUL44) and UL57/3 (aa 545 to 601 of pUL57) of HCMV, containing glycine-rich.

The activity of MRP1-EYFP is analogous to wild-type MRP1.

OsSHI1 Physically Interacts with IPA1.

Predicted pathogenic BRCA1 amino acid substitutions are confined to the evolutionarily conserved N- and C-terminal domains. Predicted pathogenic BRCA1.

A, Schematic diagram of identified splice variants of PD-L1.

Comparison of the van gene clusters.

MLK4 Is Required for H2A.Z Deposition and H4 Acetylation.

Presentation transcript:

Molecular characterization of VAB Molecular characterization of VAB. (A) Schematic representation of VAB structure. Molecular characterization of VAB. (A) Schematic representation of VAB structure. (B) Deduced amino acid sequence of VAB. Underlining indicates the region of the PH domain. (C-E) Subcellular localization of VAN3-sGFP (C) and VAB-eYFP (D), and their merged image (E). (F-I) BiFC analysis of VAN3 and VAB. (F,G) YFP fluorescence (F) and DIC images (G) of protoplasts co-transformed with VAN3-nYFP and VAB-cYFP. (H,I) YFP fluorescence (H) and DIC images (I) of protoplasts co-transformed with VAL3-nYFP and VAB-cYFP. Scale bars: 10 μm in C-E; 5μ m in F-I. Satoshi Naramoto et al. Development 2009;136:1529-1538 © 2009.