Alignment of the deduced amino acid sequence of rat olfactory CNCβ1b with bovine rod CNCβ1a. Alignment of the deduced amino acid sequence of rat olfactory.

Slides:

Advertisements

Similar presentations

Calmodulin controls the rod photoreceptor CNG channel through an unconventional binding site in the N ‐ terminus of the β ‐ subunit by Dietmar Weitz, Martin.

Advertisements

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Structure and function of voltage-gated Na+ channels. A

Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,

Sequence alignment of C-terminal phosphorylated plant aquaporins

Sequence and comparison of the SDS protein.

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

Multiple sequence alignment and analysis of SOFL proteins.

Figure 1. Type and distribution within KCNQ2 protein of variants in self-limiting epilepsy vs epileptic encephalopathy Type and distribution within KCNQ2.

Phosphorylation of a tyrosine residue in mGluR1a-CT1 by Fyn.

Answers and Questions from the KvAP Structures

Phosphopeptides identified harboring minimal binding motifs

Volume 79, Issue 4, Pages (August 2013)

Progress in Molecular Genetics of Heritable Skin Diseases: The Paradigms of Epidermolysis Bullosa and Pseudoxanthoma Elasticum Jouni Uitto, Leena Pulkkinen,

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

Jian Liu, Steven A. Siegelbaum Neuron

Figure 2 The p.Lys33Gln mutation eliminates a conserved salt bridge interaction of the matrix network The p.Lys33Gln mutation eliminates a conserved salt.

Calcium channel structure and ligand binding sites.

STAT Genes Found in C. elegans

De Novo Mutations in the Sodium-Channel Gene SCN1A Cause Severe Myoclonic Epilepsy of Infancy Lieve Claes, Jurgen Del-Favero, Berten Ceulemans, Lieven.

Blaise Z Peterson, Carla D DeMaria, David T Yue Neuron

Deletions in L-type calcium channel α1 subunit testicular transcripts correlate with testicular cadmium and apoptosis in infertile men with varicoceles

Volume 23, Issue 1, Pages 7-10 (May 1999)

Ligand Binding to the Voltage-Gated Kv1

Sequence alignment of PHCCEx domains with secondary structure elements of the Tiam2 PHCCEx domain at the top. Sequence alignment of PHCCEx domains with.

Schematic diagram of the proposed structure of CFTR

Structure and Mechanism of Yeast RNA Triphosphatase

Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Protein sequence alignments for the BcfD (A) and StfH (B) allelic.

Volume 86, Issue 6, Pages (June 2004)

Chapter 18 GABA Copyright © 2012, American Society for Neurochemistry. Published by Elsevier Inc. All rights reserved.

Extrapore Residues of the S5-S6 Loop of Domain 2 of the Voltage-Gated Skeletal Muscle Sodium Channel (rSkM1) Contribute to the μ-Conotoxin GIIIA Binding.

Energetics of Pore Opening in a Voltage-Gated K+ Channel

Localization of Divalent Cation-Binding Site in the Pore of a Small Conductance Ca2+- Activated K+ Channel and Its Role in Determining Current-Voltage.

Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development K. Kosaki,

iraL shares sequence identity with iraM from E

Identification of the GCS1 ortholog in Gonium pectorale.

Molecular Genetics of the Caveolin Gene Family: Implications for Human Cancers, Diabetes, Alzheimer Disease, and Muscular Dystrophy Jeffrey A. Engelman,

G protein coupled receptors

AKAP15 coimmunoprecipitates with CaV1

Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.

Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.

(A) Deduced amino acid sequence of the D2SV cDNA cloned from the mouse heart RNA. The novel 20 amino acid C-terminus (CT) is underlined. (A) Deduced amino.

Amino acid sequence deduced from the sequence of contig 131 of G

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Alignment of the fast/developmental and IIM MYH genes.

Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Structure of PrfA (A) and its target DNA sequences in PrfA-regulated promoters (B). Structure of PrfA (A) and its target DNA sequences in PrfA-regulated.

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

RAD51 interacts with SUMO-1 through its SIM

Phosphopeptides identified harboring minimal binding motifs

Phylogenetic analysis of AquK2P.

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

Figure 2 Compound heterozygous mutations in ADAM22

Structural Basis of Inward Rectification

Structural features of Rps26a.

Hymenoptera venom protease allergens

Nucleotide and predicted amino acid sequence of the adult mouse brain cdr2 cDNA. Nucleotide and predicted amino acid sequence of the adult mouse brain.

Gene regulatory regions of the insect/crustacean egr-B homologs.

Nomenclature of Voltage-Gated Calcium Channels

Primary structure of zebra finch CREB

A Distinct Contribution of the δ Subunit to Acetylcholine Receptor Channel Activation Revealed by Mutations of the M2 Segment Jian Chen, Anthony Auerbach

A, protein structure and functional domains of hdbpB/YB-1, hdbpA, hdbpC, NF-YA, NF-YB, and NF-YC. A, protein structure and functional domains of hdbpB/YB-1,

A, structure of the deduced polypeptides coded by MAGE-E1 mRNAs.

Structural features of seven streptococcal cell surface proteins that function in adherence and colonization. Structural features of seven streptococcal.

Structure of the HLA-DR10 β subunit and ligand binding sites.

Sequence alignment of colicin lysis proteins.

TRPC5 ion conduction pathway compared with TRPC4 and other TRPCs

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

Alignment of the deduced amino acid sequence of rat olfactory CNCβ1b with bovine rod CNCβ1a. Alignment of the deduced amino acid sequence of rat olfactory CNCβ1b with bovine rod CNCβ1a. Numbersindicate positions of amino acid residues in the polypeptide. The sequence of CNCβ1a is presented starting at residue 498.Colons and periods between the two sequences indicate identical residues and conservative substitutions, respectively. Structural features similar to those of α subunits are represented by lines above the sequence.S1–S6, Membrane-spanning segments; S4, voltage sensor-like motif; P, the pore motif that lines the cavity of the channel; CaM, a nonconventional calmodulin-binding site (Weitz et al., 1998). Arrowheadindicates an exon boundary identified in human rod CNCβ1a (Ardell et al., 1996). Wolfgang Bönigk et al. J. Neurosci. 1999;19:5332-5347 ©1999 by Society for Neuroscience