Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

Slides:

Advertisements

Similar presentations

The cloning and expression of SNAP-25a and b in zebrafish Maia Lavarias*, Dr. Wendy Boehmler Department of Biology, York College of Pennsylvania, York,

Advertisements

MVKFLFSVIILFFLLSAVGSSARNIEEDGVIRLPSEVKDFINGKNIDDDSVGGTRWAVLI 60 AGSSGYWNYRHQADVCHAYQVLKRGGVKDENIVVFMYDDIALNEENPRPGVIINHPKGED 120 VYAGVPKDYTGRDVTAHNFYSVLLGNKTAVKGGSGKVIDSGPNDHIFIYYSDHGGPGVLG.

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Supplemental Fig. S1 A B AtMYBS aa AtMYBS

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Volume 88, Issue 5, Pages (March 1997)

Sequence and expression of Xenopus EAF2.

Supplemental Figure S2. Sequence comparison of the Arabidopsis homologue of PAHX with human PHYD1 (phytanoyl-CoA dioxygenase domain containing 1) and human.

Sequence alignment of C-terminal phosphorylated plant aquaporins

Sequence and comparison of the SDS protein.

Multiple sequence alignment of S

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

Multiple sequence alignment and analysis of SOFL proteins.

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

Phosphopeptides identified harboring minimal binding motifs

Explore Evolution: Instrument for Analysis

Schematic representation of the lbk gene, positions of gRNAs, and knock-in cassette. Schematic representation of the lbk gene, positions of gRNAs, and.

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

Volume 88, Issue 5, Pages (March 1997)

Genomic context, sequence identity, and structural homology modeling of the aadA31 gene detected in P. multocida PM13 and H. somni HS31. Genomic context,

Clustering of Activating Mutations in c-KIT’s Juxtamembrane Coding Region in Canine Mast Cell Neoplasms Yongsheng Ma, B. Jack Longley, Xiaomei Wang

Amino acid alignment of TprK showing six different sequences in the T

Isolation of a Microsporum canis Gene Family Encoding Three Subtilisin-Like Proteases Expressed in vivo Frédéric Descamps, Frédéric Brouta, Didier Baar,

De Novo Mutations in the Sodium-Channel Gene SCN1A Cause Severe Myoclonic Epilepsy of Infancy Lieve Claes, Jurgen Del-Favero, Berten Ceulemans, Lieven.

Comparison of the variable regions of (A) pHNZY32, pHNZY118, and pHNAH24; (B) pHNMCC14; (C) pHNFKU92; (D) pE80; (E) pECB11; (F) p42-2; and (G) pSLK172-2.

Volume 28, Issue 6, Pages (December 2007)

N-terminal extension of a gene using peptides mapping upstream to an annotated start site. N-terminal extension of a gene using peptides mapping upstream.

Qiong A. Liu, Michael O. Hengartner Current Biology

Daniel Peisach, Patricia Gee, Claudia Kent, Zhaohui Xu Structure

Sadaf Naz, Chantal M. Giguere, David C. Kohrman, Kristina L

Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Protein sequence alignments for the BcfD (A) and StfH (B) allelic.

L. Aravind, Eugene V. Koonin Current Biology

Bioinformatics analysis of the small TbTim amino acid sequences.

Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development K. Kosaki,

iraL shares sequence identity with iraM from E

Identification of the GCS1 ortholog in Gonium pectorale.

Correction of Gene Annotation and Other Sequence Analysis of Arabidopsis Proteins Identified on the 2-D Gels in Figure 1.(A) Spot 71, identified as a 17.2-kD.

Phylogenetic analysis and amino acid sequences comparison of HO endonucleases. Phylogenetic analysis and amino acid sequences comparison of HO endonucleases.

The Gene Mutated in Variant Late-Infantile Neuronal Ceroid Lipofuscinosis (CLN6) and in nclf Mutant Mice Encodes a Novel Predicted Transmembrane Protein

Molecular Genetics of the Caveolin Gene Family: Implications for Human Cancers, Diabetes, Alzheimer Disease, and Muscular Dystrophy Jeffrey A. Engelman,

AKAP15 coimmunoprecipitates with CaV1

Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.

Shifty Ciliates Lawrence A. Klobutcher, Philip J. Farabaugh Cell

The C-terminal membrane-proximal region of MARCH8 interacts with TfR.

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

(A) yellow cDNA comparison among wild-type and ch mutants

Sequence Analysis Alan Christoffels

Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

(A) Segregation of mutations in TMEM231 in JBTS families.

RAD51 interacts with SUMO-1 through its SIM

Phosphopeptides identified harboring minimal binding motifs

Comparison of the sequences of Fzo/Mfn and structure of mammalian Mfn2

Alignment of the deduced amino acid sequence of rat olfactory CNCβ1b with bovine rod CNCβ1a. Alignment of the deduced amino acid sequence of rat olfactory.

Figure 2 Compound heterozygous mutations in ADAM22

A Missense Mutation in a Highly Conserved Region of CASQ2 Is Associated with Autosomal Recessive Catecholamine-Induced Polymorphic Ventricular Tachycardia.

Sequence comparisons of fungal HOG1 orthologues.

OMV-enriched proteins show a conserved N-terminal LES motif.

Depiction of wild-type and mutated Hes6 proteins.

Nucleotide and predicted amino acid sequence of the adult mouse brain cdr2 cDNA. Nucleotide and predicted amino acid sequence of the adult mouse brain.

Primary structure of zebra finch CREB

A, structure of the deduced polypeptides coded by MAGE-E1 mRNAs.

Structural features of seven streptococcal cell surface proteins that function in adherence and colonization. Structural features of seven streptococcal.

S. moellendorffii BBI3 Is Predicted to Be a BBI Based on Sequence Similarity at the Inhibitory Motifs and Shared Primary Protein Architecture. S. moellendorffii.

John Gray, Pam S Close, Steven P Briggs, Gurmukh S Johal Cell

Multiple alignment of type I and III IFNs from Xenopus, chicken, and human. Multiple alignment of type I and III IFNs from Xenopus, chicken, and human.

Amino acid sequence similarity among C

Amino acid sequence of antigenic fragments 52/3 and UL57/3 of pUL44 and pUL57, respectively, and sequence comparison by dot plot analysis. Amino acid sequence.

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203), M. racemosusRas3 and Ras2, murine K-Ras2, murine Gem, and human Rad. Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203), M. racemosusRas3 and Ras2, murine K-Ras2, murine Gem, and human Rad. The G1–G5 regions, the position of the Rit and Rin deletions (del I and del II), the conserved basic residues (asterisks), and the location of the C-terminal-most cysteine residue (arrow) in Rit and Rin are indicated. The word “insertion” indicates the position of the 64 bp insertion in the humanRin ESTs. The CAAX motifs in Ras3, Ras2, and K-Ras areboxed, as are the cysteines located seven residues from the C terminus in Gem and Rad. Black and gray shadingindicate sequence identity and conservative substitutions, respectively. Homology comparisons were performed using the BLAST algorithm (NCBI). Sequences were aligned using ClustalW (Higgins and Sharp, 1988) and displayed using BOXSHADE. Ching-Hsien J. Lee et al. J. Neurosci. 1996;16:6784-6794 ©1996 by Society for Neuroscience