Structural features of Rps26a.

Slides:

Advertisements

Similar presentations

Brief Overview of Macromolecules DNA, RNA, and Proteins.

Advertisements

Protein sequences and three‐dimensional structures of HUB1 (homologous to ubiquitin 1), ubiquitin and ubiquitin‐like modifiers. Protein sequences and three‐dimensional.

Molecular evolution: Actin's long lost relative found

Amino‐acid sequence of the heterogeneous nuclear RNP G protein family and RNA‐binding SELEX consensus sequence obtained for human RBMY. (A) Sequence alignment.

Volume 27, Issue 6, Pages (September 2007)

Structure of the mouse stomatin domain.

Structural Basis of the Redox Switch in the OxyR Transcription Factor

Motif 1 Motif 3 Motif 6 Motif 2 Motif 5 Motif 4 Motif 4 Motif 1

Crystal Structure of M. tuberculosis ABC Phosphate Transport Receptor

Volume 11, Issue 6, Pages (June 2003)

Sebastian Meyer, Raimund Dutzler Structure

Volume 24, Issue 11, Pages e2 (November 2017)

HOPX: The Unusual Homeodomain-Containing Protein

Volume 27, Issue 6, Pages (September 2007)

Volume 93, Issue 4, Pages (May 1998)

Tom Huxford, De-Bin Huang, Shiva Malek, Gourisankar Ghosh Cell

Volume 8, Issue 2, Pages (August 2001)

Volume 17, Issue 5, Pages (May 2009)

Structure of Bacteriophage T4 RNase H, a 5′ to 3′ RNA–DNA and DNA–DNA Exonuclease with Sequence Similarity to the RAD2 Family of Eukaryotic Proteins

Volume 130, Issue 6, Pages (September 2007)

Nadine Keller, Jiří Mareš, Oliver Zerbe, Markus G. Grütter Structure

Solution and Crystal Structures of a Sugar Binding Site Mutant of Cyanovirin-N: No Evidence of Domain Swapping Elena Matei, William Furey, Angela M.

a MELLFLGTGAGIPAKARNVTSVALKLLEERRSVWLFDCGEATQHQILHTT

Three-dimensional structure of B. subtilis PRPP synthase.

Structure and Mechanism of Homoserine Kinase

Volume 28, Issue 6, Pages (December 2007)

Volume 11, Issue 6, Pages (June 2003)

Andrew H. Huber, W.James Nelson, William I. Weis Cell

Volume 90, Issue 1, Pages (July 1997)

Daniel Peisach, Patricia Gee, Claudia Kent, Zhaohui Xu Structure

Volume 23, Issue 3, Pages (August 2006)

Noncatalytic Assembly of Ribonuclease III with Double-Stranded RNA

Volume 14, Issue 2, Pages (April 2004)

Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Protein sequence alignments for the BcfD (A) and StfH (B) allelic.

Volume 8, Issue 5, Pages (November 2001)

Mark Del Campo, Alan M. Lambowitz Molecular Cell

Crystal Structure of a Phosphoinositide Phosphatase, MTMR2

Tianjun Zhou, Liguang Sun, John Humphreys, Elizabeth J. Goldsmith

L. Aravind, Eugene V. Koonin Current Biology

Volume 29, Issue 6, Pages (March 2008)

Bioinformatics analysis of the small TbTim amino acid sequences.

Jeffrey J. Wilson, Rhett A. Kovall Cell

Relative ITS2 abundance of Saccharomyces in stool over time as a Saccharomyces cerevisiae-free diet was consumed. Relative ITS2 abundance of Saccharomyces.

Volume 130, Issue 6, Pages (September 2007)

Crystal Structure of the Human Myeloid Cell Activating Receptor TREM-1

Structure of the Staphylococcus aureus AgrA LytTR Domain Bound to DNA Reveals a Beta Fold with an Unusual Mode of Binding David J. Sidote, Christopher.

Volume 14, Issue 6, Pages (June 2006)

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Fig. 4. The predicted protein domains in sma

General structure of RIFINs and STEVORs

Volume 17, Issue 5, Pages (May 2009)

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

RAD51 interacts with SUMO-1 through its SIM

Motif sequence logo and surface analysis of LC8.

Structural insights based on chimeric Alp4-GCP2 analysis.

Molecular characterization of the key motifs of AnMac1.

Three protein kinase structures define a common motif

ITS rRNA gene locus. ITS rRNA gene locus. Schematic of the eukaryotic ribosomal gene cluster. The SILVA database contains sequences of the 18S gene, while.

Sequence comparisons of fungal HOG1 orthologues.

OMV-enriched proteins show a conserved N-terminal LES motif.

Molecular structure of MFS1 promoter genotypes.

Predicted Amino Acid Sequence of the Tomato Cf-4 Protein (Thomas et al

Phylogenetic relationships between PBVs isolated in this study and representative members of the family Picobirnaviridae, based on the amino acid sequence.

Structural Switch of the γ Subunit in an Archaeal aIF2αγ Heterodimer

Crystal Structure of Escherichia coli RNase D, an Exoribonuclease Involved in Structured RNA Processing Yuhong Zuo, Yong Wang, Arun Malhotra Structure

PHs of olive brines. pHs of olive brines. The average ± standard deviation (SD) of two independent replicates at each time point is shown. Acetic acid.

C. neoformans encodes a single family 2 DHODH required for wild-type growth. C. neoformans encodes a single family 2 DHODH required for wild-type growth.

IF2 and structural homologues.

Sequence alignment of colicin lysis proteins.

Residues 327 and 404 are key binding sites for GII. 4F MAb

Presentation transcript:

Structural features of Rps26a. Structural features of Rps26a. (A) Crystal structure of S. cerevisiae Rps26 (adapted from PDB 3U5G and drawn using PyMOL Molecular Graphics System [Schrodinger, Germany]). The β-strand containing the eukaryote-specific motif 62-YALPKTYNK-70 (22) and its mirror sequence on the opposite β-strand are shown in green and blue, respectively. The COOH and NH2 termini are indicated. (B) Multiple alignment of Rps26 proteins from S. cerevisiae, Homo sapiens, and Staphylothermus marinus. The eukaryote-specific motif and its mirror sequence are shown in green and blue, respectively. Sequence regions of low similarity, located predominantly within both β-strands and in the α-helical region in the middle of the molecule, are indicated in boldface. The amino acid numbers are based on the sequence of S. cerevisiae Rps26a. Alexander Belyy et al. mSphere 2016; doi:10.1128/mSphere.00109-15