Excerpt from the Hsp70 sequence alignment showing some of the important sequence signatures (boxed regions) distinguishing eukaryotic nuclear-cytosolic.

Slides:

Advertisements

Similar presentations

Plagiarism is… N. 1The appropriation or imitation of the language, ideas, and thoughts of another author, and representative of them as one’s original.

Advertisements

1 Cellular Characteristics Prokaryotes Eukaryotes.

Cell Review Eukaryotes Animal Cell Bacteria Prokaryotes Plant Cell

Research! Look up each antibiotic from our lab and describe what it does to bacteria. As a group, draw a picture that you think best represents.

Cell Types Daily Quiz 1. List 4 differences between Eukaryotic cells and Prokaryotic cells.

Bacterial Protein Translocation & Pathogenesis

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Chapter 6 The Cell: Nucleus, Ribosomes

Molecular evolution: Actin's long lost relative found

Submitted by:- DR.Madhurima Sharma PGGCG-II,Chandigarh

Bacteria and Archaea Chapter 27

KEY CONCEPT Cells are the Basic unit of life.

Electromagnetic fields stress living cells

Pathogenicity Islands: Bacterial Evolution in Quantum Leaps

Enhanced surveillance of carbapenemase-producing Gram-negative bacteria to support national and international prevention and control efforts R. Freeman

Reversing Time: Origin of Telomerase

Screenshot of JCVI's Advanced Reference Viewer ( jcvi

Sponge Explain the process of mitosis in your own words.

Structure of CheA, a Signal-Transducing Histidine Kinase

Phylogenetic analysis of replication proteins expressed by bifidobacterial plasmids. Phylogenetic analysis of replication proteins expressed by bifidobacterial.

Amino acid alignment of TprK showing six different sequences in the T

Phylogenetic tree of perA A2-domain DNA sequence.

Collective shifts of abundance for nuclear and extracellular proteins in colorectal cancer Collective shifts of abundance for nuclear and extracellular.

Andrew E. Blanchard, Mark J. Arcario, Klaus Schulten, Emad Tajkhorshid

Phylogenetic analysis of PurR from low-GC Gram-positive bacteria.

Phrap assemblies visualized with the Consed (53) program.

Summary of Protein Trafficking

Phylogenetic trees of the closest eukaryotic homologs of clones AY and AY Phylogenetic trees of the closest eukaryotic homologs of clones.

Alignments of the complete genome sequences of the B

CTL killing and hepatocyte replacement.

Composition of the SoxABCD terminal oxidase of S. acidocaldarius.

Identification of the GCS1 ortholog in Gonium pectorale.

Structures of hydrophobic signaling molecules produced by diatoms and bacteria. Structures of hydrophobic signaling molecules produced by diatoms and bacteria.

Origins of replication and related regions of some representative theta-replicating plasmids from gram-negative bacteria. Origins of replication and related.

Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.

DNA methylation of the Xist gene.

Volume 26, Issue 17, Pages (September 2016)

Sequence Analysis Alan Christoffels

Broadly conserved proteins of the type III secretion apparatus and of the flagellum biosynthesis systems in B. subtilis and E. coli/S. typhimurium. Broadly.

Summary of major events in Earth history relating to the appearance of eukaryotic groups and the appearance of O2 in the atmosphere and in marine environments.

Neighbor-joining distance tree based on Hsp90 sequences indicating that the cytosolic and ER resident forms of these protein form paralogous gene families,

Gel-filtration chromatography of the active fractions from the Mono-Q column marked by the horizontal bar in Fig. 1. Gel-filtration chromatography of the.

Schematic representation of the hydrolysis of amorphous and microcrystalline cellulose by noncomplexed (A) and complexed (B) cellulase systems. Schematic.

Hector H. García et al. Clin. Microbiol. Rev. 2002; doi: /CMR

Structure of the Xist gene.

T4P gene clusters in C. perfringens and C. difficile.

Simplified neighbor-joining tree of ABC domains.

Prophage genome map of the C. diphtheriae prophage encoding DT

Roberta B. Carey et al. Clin. Microbiol. Rev. 2018; doi: /CMR

Molecular models for module exchange between phages.

Simple CRP regulation operates through two related mechanisms, designated class I and class II. Both classes depend on specific interactions between CRP.

Incorporation of new cell wall in differently shaped bacteria.

Structural features of seven streptococcal cell surface proteins that function in adherence and colonization. Structural features of seven streptococcal.

Conserved motifs in the ABC

Simple insertions and cointegrate formation.

Structure of peptidoglycan of S. aureus and several other bacteria.

Two organelles in comparison.

Schematics of PilB assembly ATPases.

Alignment of PilT retraction ATPases.

IS200 complex. IS200 complex. (A) Organization of IS200. Short IRs (open arrows) are shown at the left end, and the relative position of the potential.

Organization of a typical IS

IF2 and structural homologues.

Amino acid sequence similarity among C

Sequence alignment of colicin lysis proteins.

DDE consensus of different families.

16S rRNA-based phylogeny of sponge-associated cyanobacteria and chloroplasts. 16S rRNA-based phylogeny of sponge-associated cyanobacteria and chloroplasts.

Unrooted neighbor-joining tree of 16S rRNA gene sequences from low-G+C-content gram-positive bacteria, obtained from clone libraries. Unrooted neighbor-joining.

Lipid and peptidoglycan attachment of the murein (Braun’s) lipoprotein of E. coli. Lipid and peptidoglycan attachment of the murein (Braun’s) lipoprotein.

Diagram of the structures of several anchored surface proteins from various gram-positive bacteria. Diagram of the structures of several anchored surface.

Presentation transcript:

Excerpt from the Hsp70 sequence alignment showing some of the important sequence signatures (boxed regions) distinguishing eukaryotic nuclear-cytosolic homologs from prokaryotic and organellar homologs. Excerpt from the Hsp70 sequence alignment showing some of the important sequence signatures (boxed regions) distinguishing eukaryotic nuclear-cytosolic homologs from prokaryotic and organellar homologs. G− and G+ refer to gram-negative bacteria and gram-positive bacteria, respectively. The boxed region marked ➁ shows the diderm insert in the N-terminal quadrant common to all eukaryotic homologs and gram-negative bacteria. The signatures marked ➀ and ③ identify two indels that distinguish eukaryotic nuclear-cytosolic homologs from all organellar and prokaryotic homologs. Other prokaryotic homologs not included in this alignment (e.g., some shown in Fig. 3) also contained the indicated signature sequences. Not all signature sequences of the above kinds are shown. The notation (e) in parentheses identifies ER Hsp70 homologs. Mitochond. and hydrogeno. refer to mitochondria and hydrogenosome homologs. Radhey S. Gupta Microbiol. Mol. Biol. Rev. 1998; doi: