Formation of complex antibiotic resistance regions.

Slides:

Advertisements

Similar presentations

Area between curves. How would you determine the area between two graphs?

Advertisements

20-3: Complex Resistor Combinations

Introduction to Molecular Genetics Studiju materiāli / MolekularasBiologijas / Ievads MolGen / EN.

Bacterial Transposons Author Meenakshi Agarwal, Mehta Gunjan Mentor Dr. Santanu Ghosh.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Genética Microbiana y de Levaduras II

Schematic drawing of the human X chromosome and physical map the Xp interval carrying the ND gene. A 640-kb yeast artificial chromosome (YAC) clone was.

Accumulation of transcripts from MULE‐F19G14–CyP40 and transposons in mom1 and ddm1. Accumulation of transcripts from MULE‐F19G14–CyP40 and transposons.

by Franz F. Wagner, and Willy A. Flegel

PCR genotype analysis to determine RNP-mediated knockout efficiency in C. lusitaniae. PCR genotype analysis to determine RNP-mediated knockout efficiency.

Mark M Metzstein, H.Robert Horvitz Molecular Cell

Schematic view of SGI1-L and its specific features encountered in Morganella morganii strain LIM90. Schematic view of SGI1-L and its specific features.

Trimeric association of TMDs of Ebola virus GP, SARS CoV S, rabies virus GP, and influenza virus HA, as determined by SE-AUC. Trimeric association of TMDs.

High prevalence of ST-78 infection-associated vancomycin-resistant Enterococcus faecium from hospitals in Asunción, Paraguay M.A. Khan, J.B. Northwood,

Volume 9, Issue 4, Pages (October 2011)

Novel and uncommon antimicrobial resistance genes in livestock-associated methicillin- resistant Staphylococcus aureus K. Kadlec, A.T. Feßler, T. Hauschild,

Temporal expression of the transgenic human protamine gene cluster

Volume 6, Issue 7, Pages (July 1996)

What number is the arrow pointing at?

Dissemination of multidrug-resistant, class 1 integron-carrying Acinetobacter baumannii isolates in Taiwan L.-Y. Huang, T.-L. Chen, P.-L. Lu, C.-A. Tsai,

Supplemental Figure 3 A B C T-DNA 1 2 RGLG1 2329bp 3 T-DNA 1 2 RGLG2

Genomic context, sequence identity, and structural homology modeling of the aadA31 gene detected in P. multocida PM13 and H. somni HS31. Genomic context,

Extra chromosomal Agents Transposable elements

Comparison of the variable regions of (A) pHNZY32, pHNZY118, and pHNAH24; (B) pHNMCC14; (C) pHNFKU92; (D) pE80; (E) pECB11; (F) p42-2; and (G) pSLK172-2.

Expression response of AT-rich genes to lanthanides.

FepB is responsible for the smr mutant’s phenotype.

Volume 37, Issue 6, Pages (March 2010)

Polymorphism discovery in 09-CB1 × IPO323 versus 09-ASA-3apz × IPO94269 bulks. Polymorphism discovery in 09-CB1 × IPO323 versus 09-ASA-3apz × IPO94269.

The Bare Lymphocyte Syndrome: Molecular Clues to the Transcriptional Regulation of Major Histocompatibility Complex Class II Genes Angela DeSandro, Uma.

Figure 9. Categories of pha-siRNA-yielding genes

Assembly of the novel bat gammaherpesvirus genome highlights ORFs related to EHV-2 and accessory ORFs related to other gammaherpesviruses. Assembly of.

Comparative analysis of Aeromonas sp.

Histidine kinases are expanded in the fusaria.

Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Protein sequence alignments for the BcfD (A) and StfH (B) allelic.

The mlenapts RNA Helicase Mutation in Drosophila Results in a Splicing Catastrophe of the para Na+ Channel Transcript in a Region of RNA Editing Robert.

High-density foci of Giardia colonization are present in the proximal small intestine of mice and gerbils. High-density foci of Giardia colonization are.

Figure 1. Sequence comparison of plasmid pG38 (GenBank accession no

Whole-genome comparison of E

Multidrug resistance-encoding plasmid from Aeromonas sp. strain P2GI

S. pneumoniae GapA is sensitive to oxygen and H2O2 exposure.

Introduction of an autocatalytic hammerhead ribozyme sequence permits use of the optimal T7 promoter to enhance transcription levels. Introduction of an.

RNA-Seq analysis of CYR1 cells in the adaptation to acid pH.

C. difficile colonization alters gene transcription of taxonomic groups differentially between antibiotic pretreatments. C. difficile colonization alters.

Organization of TCAST elements within T

The Bov-A2 element is conserved in the NOS2 gene of bovid species.

TEM observation of the bacterial damage caused by egg white.

Functional distribution of genes activated upon exposure to C

Structure of Wt1 genomic regions in human and zebrafish.

Phenotypic and genotypic features of bacteriophage Andhra.

The two-plasmid CRISPRi-system.

Phylogenetic analysis of K. quasipneumoniae subsp

A Complex Rearrangement in the APC Gene Uncovered by Multiplex Ligation- Dependent Probe Amplification Constanze Pagenstecher, Dorothea Gadzicki, Dietlinde.

Bacterial composition of olive fermentations is affected by microbial inoculation. Bacterial composition of olive fermentations is affected by microbial.

ITS rRNA gene locus. ITS rRNA gene locus. Schematic of the eukaryotic ribosomal gene cluster. The SILVA database contains sequences of the 18S gene, while.

KEGG cluster of DEGs of S

Fig. 3 Classification of gene essentiality by transposon mutagenesis.

Comparison of community fungal and bacterial/archaeal diversity levels

Molecular structure of MFS1 promoter genotypes.

Distribution of the diversity numbers of antibiotic resistance and virulence factor protein families by environmental metagenomes’ protein family richness.

Normalized abundance of tetracycline resistance genes in Swedish infants by AMR++. Normalized abundance of tetracycline resistance genes in Swedish infants.

Simple insertions and cointegrate formation.

Distribution of selected traits across the >4,000 strains in the most recent version of the database, including cell shape (A), spore formation (B), motility.

ROS Generation, Defense Gene Expression, and Histone Acetylation Levels in the HDT701 OX and RNAi Plants.(A) ROS level in HDT701 RNAi plants after flg22.

Primary screening results of the MMV Malaria Box library.

Distinct antibiotic pretreatments have differential impacts on C

Impact of the SOS activities on E. coli mutation rates.

Integrated analysis of gene expression and copy number alterations.

IS200 complex. IS200 complex. (A) Organization of IS200. Short IRs (open arrows) are shown at the left end, and the relative position of the potential.

GBM 112 and GBM 144 cells infected in vitro with HCMV resist growth inhibition by temozolomide. GBM 112 and GBM 144 cells infected in vitro with HCMV resist.

Expression levels of additional giardia genes in elutriation fractions

Presentation transcript:

Formation of complex antibiotic resistance regions. Formation of complex antibiotic resistance regions. (A) Structure of Tn6026. (B) Building transposons using TUs derived from Tn4352 and Tntet(D). The origin of each IS26-bounded structure is shown above. Genes and open reading frames are shown as arrows indicating the direction of transcription. Genes conferring antibiotic resistance are black. IS26 elements are shown as open boxes with an arrow indicating the position and orientation of tnp26. Christopher J. Harmer, and Ruth M. Hall mSphere 2016; doi:10.1128/mSphere.00038-16