Structural features of seven streptococcal cell surface proteins that function in adherence and colonization. Structural features of seven streptococcal.

Slides:

Advertisements

Similar presentations

Proteins and Polypeptides

Advertisements

Lecture 08 - Translation Based on Chapter 6 Gene Expression: Translation Copyright © 2010 Pearson Education Inc. What is the chemical composition of a.

Protein Properties Function, structure Residue features Targeting Post-trans modifications BIO520 BioinformaticsJim Lund Reading: Chapter , 11.7,

Finding genes in the genome

Chapter 14. Examples of Homonuclear 2D Experiments.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

There are four levels of structure in proteins

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

Weapons delivery & deployment

Shogo Ito, Young Hun Song, Takato Imaizumi Molecular Plant

Phosphopeptides identified harboring minimal binding motifs

Volume 34, Issue 4, Pages (May 2009)

Clustering of Activating Mutations in c-KIT’s Juxtamembrane Coding Region in Canine Mast Cell Neoplasms Yongsheng Ma, B. Jack Longley, Xiaomei Wang

Structure of CheA, a Signal-Transducing Histidine Kinase

Allosteric site of B. subtilis PRPP synthase.

SYCE2 directly binds to the chromoshadow domain of HP1α.

Rules for Nuclear Localization Sequence Recognition by Karyopherinβ2

Solar spectrum in space (thin line) and on Earth's surface (thick line). Solar spectrum in space (thin line) and on Earth's surface (thick line). Below.

Correction of translational start site by identification of N-terminal peptide. Correction of translational start site by identification of N-terminal.

N-terminal extension of a gene using peptides mapping upstream to an annotated start site. N-terminal extension of a gene using peptides mapping upstream.

Antigen Presentation: Kissing cousins exchange CLIP

Phrap assemblies visualized with the Consed (53) program.

Catalytic strategies. Catalytic strategies. The coordination of Mg2+ (shown as blue spheres) of the active site to the substrates, to amino acid residues,

Daniel Peisach, Patricia Gee, Claudia Kent, Zhaohui Xu Structure

Possible secondary structure of the S. enterica prs leader.

Crystallographic Analysis of the Recognition of a Nuclear Localization Signal by the Nuclear Import Factor Karyopherin α Elena Conti, Marc Uy, Lore Leighton,

Characteristics of the new family of telomeric Cryptosporidium proteins, Cops-1 and Chos-1. Characteristics of the new family of telomeric Cryptosporidium.

Composition of the SoxABCD terminal oxidase of S. acidocaldarius.

Identification of the GCS1 ortholog in Gonium pectorale.

Origins of replication and related regions of some representative theta-replicating plasmids from gram-negative bacteria. Origins of replication and related.

Shifty Ciliates Lawrence A. Klobutcher, Philip J. Farabaugh Cell

Alignment of N-terminal sequences of type IV pilin proteins.

Amino acid sequence deduced from the sequence of contig 131 of G

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Fig. 4. The predicted protein domains in sma

Schematic representation of the domain structures of insect enzymes involved in chitin metabolism. Schematic representation of the domain structures of.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Summary of major events in Earth history relating to the appearance of eukaryotic groups and the appearance of O2 in the atmosphere and in marine environments.

Structure of PrfA (A) and its target DNA sequences in PrfA-regulated promoters (B). Structure of PrfA (A) and its target DNA sequences in PrfA-regulated.

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Phosphopeptides identified harboring minimal binding motifs

Structure of an IκBα/NF-κB Complex

Alignment of the deduced amino acid sequence of rat olfactory CNCβ1b with bovine rod CNCβ1a. Alignment of the deduced amino acid sequence of rat olfactory.

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

Selectivity-determining regions

T4P gene clusters in C. perfringens and C. difficile.

SMase cleavage sites in sphingomyelin and cellular activities of the reaction products. SMase cleavage sites in sphingomyelin and cellular activities of.

Physiological effects of heat shock.

Simplified neighbor-joining tree of ABC domains.

Prophage genome map of the C. diphtheriae prophage encoding DT

Molecular models for module exchange between phages.

Building blocks and synthesis reactions of the peptidoglycan.

Structure of an exporter.

Genome organization and polyprotein products of human astrovirus.

Simple CRP regulation operates through two related mechanisms, designated class I and class II. Both classes depend on specific interactions between CRP.

Concerted model for maltose transport.

Conserved motifs in the ABC

Volume 97, Issue 6, Pages (June 1999)

Structures of T4 pilins and minor pilins.

The Alp family of proteins.

IF2 and structural homologues.

Multiple alignment of type I and III IFNs from Xenopus, chicken, and human. Multiple alignment of type I and III IFNs from Xenopus, chicken, and human.

Amino acid sequence similarity among C

Schematic presentation of the major domains of Alps, the signal peptide (S), the N-terminal region (N), the repeat region (R), and the C-terminal region.

Sequence alignment of colicin lysis proteins.

Volume 95, Issue 2, Pages (October 1998)

Amino acid sequence of antigenic fragments 52/3 and UL57/3 of pUL44 and pUL57, respectively, and sequence comparison by dot plot analysis. Amino acid sequence.

Lipid and peptidoglycan attachment of the murein (Braun’s) lipoprotein of E. coli. Lipid and peptidoglycan attachment of the murein (Braun’s) lipoprotein.

Diagram of the structures of several anchored surface proteins from various gram-positive bacteria. Diagram of the structures of several anchored surface.

Structure of an ATP-bound ABC dimer.

Presentation transcript:

Structural features of seven streptococcal cell surface proteins that function in adherence and colonization. Structural features of seven streptococcal cell surface proteins that function in adherence and colonization. Emm6, S. pyogenes; SpaP, S. mutans; Spg, S. dysgalactiae; SfbI, S. pyogenes; Hsa, S. gordonii; SclA, S. pyogenes; ScpB, S. agalactiae. Precursor polypeptides are drawn N terminal (left) to C terminal (right), and all of the proteins are thought to be held at the cell surface through covalent cell wall anchorage (CWA) via a specialized C-terminal motif (see text). Leader (signal) peptides (SP) are cleaved at conventional sites by signal peptidase I. Specific structural features and amino acid residue repeat block regions are indicated (see descriptions in the text). Like-shaded regions across the different proteins indicate only similarities in amino acid composition or predicted secondary structure, e.g., α-helical coiled coil, and not sequence homologies. Conversely, amino acid residue repeat blocks within a polypeptide, e.g., SpaP, are highly conserved. Some of the substrates bound by the polypeptides, and the approximate locations of the binding sites, are indicated below each structure. fH, factor H; gp340, cysteine-rich scavenger protein (salivary agglutinin). Angela H. Nobbs et al. Microbiol. Mol. Biol. Rev. 2009; doi:10.1128/MMBR.00014-09