DDE consensus of different families.

Slides:

Advertisements

Similar presentations

Fig. 4-1, p Fig. 4-2, p. 109 Fig. 4-3, p. 110.

Advertisements

Slide 1Fig. 22.1, p.669. Slide 2Fig. 22.3, p.670.

Slide 1Fig. 17.1, p.513. Slide 2Table 17.1, p.514.

P.464. Table 13-1, p.465 Fig. 13-1, p.466 Fig. 13-2, p.467.

Fig. 11-1, p p. 360 Fig. 11-2, p. 361 Fig. 11-3, p. 361.

Table 6-1, p Fig. 6-1, p. 162 p. 163 Fig. 6-2, p. 164.

A B C D E F G H I J K FigS1. Supplemental Figure S1. Evolutionary relationships of Arabidopsis and tomato Aux/IAA proteins. The evolutionary history was.

Fig. 6-CO, p p. 185a p. 185b p. 185c p. 185d.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

From: Phylogenetic Analysis of the ING Family of PHD Finger Proteins

Fig. 9. Scatter plots of 500 inferred rates versus their simulated values with a model tree with six sequences and d = 0.1 for (a) ML and (b) EB-EXP. The.

by David W. Bahler, John A. Miklos, and Steven H. Swerdlow

Characterisation of OXA-51, a novel class D carbapenemase found in genetically unrelated clinical strains of Acinetobacter baumannii from Argentina S.

binding sites 58 of the 473 unambiguously assigned phosphorylation sites are predicted by Scansite to be sites for binding. 50 of these correspond.

Amino‐acid sequence of the heterogeneous nuclear RNP G protein family and RNA‐binding SELEX consensus sequence obtained for human RBMY. (A) Sequence alignment.

Motif 1 Motif 3 Motif 6 Motif 2 Motif 5 Motif 4 Motif 4 Motif 1

Prediction of protein structure

Efficacy of Serologic Marker Screening in Identifying Hepatitis B Virus Infection in Organ, Tissue, and Cell Donors Dominique Challine, Stéphane Chevaliez,

Phosphopeptides identified harboring minimal binding motifs

Secretin and vasoactive intestinal peptide receptors: Members of a unique family of G protein–coupled receptors Charles D. Ulrich, Martin Holtmann‡,

A. Papa, K. Dumaidi, F. Franzidou, A. Antoniadis

Put the dots on the shift keys.

A Lexicon for Homeodomain-DNA Recognition

Characterization of two novel gene cassettes, dfrA27 and aadA16, in a non-O1, non- O139 Vibrio cholerae isolate from China J. Sun, M. Zhou, Q. Wu, Y.

Phylogenetic analysis of replication proteins expressed by bifidobacterial plasmids. Phylogenetic analysis of replication proteins expressed by bifidobacterial.

Allosteric site of B. subtilis PRPP synthase.

Where would you draw the polyA tail in the gene above?______________

Amino acid alignment of TprK showing six different sequences in the T

Fig. 6-CO, p. 211.

W. Ibrahim, N. Boukhadra, D. Nasri-Zoghlami, P. Berthelot, S. Omar, T

Phrap assemblies visualized with the Consed (53) program.

Possible secondary structure of the S. enterica prs leader.

Finding a basis for flipping bases

Alignments of the complete genome sequences of the B

Identification of the naturally occurring genes encoding carbapenem-hydrolysing oxacillinases from Acinetobacter haemolyticus, Acinetobacter johnsonii,

Relation between cell shape of MC4100 lysAand the PBP3/PBP2 inhibition ratio. Relation between cell shape of MC4100 lysAand the PBP3/PBP2 inhibition ratio.

Hartmut Scheel, Kay Hofmann Current Biology

DNA methylation of the Xist gene.

The Bov-A2 element is conserved in the NOS2 gene of bovid species.

Broadly conserved proteins of the type III secretion apparatus and of the flagellum biosynthesis systems in B. subtilis and E. coli/S. typhimurium. Broadly.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Summary of major events in Earth history relating to the appearance of eukaryotic groups and the appearance of O2 in the atmosphere and in marine environments.

Neighbor-joining distance tree based on Hsp90 sequences indicating that the cytosolic and ER resident forms of these protein form paralogous gene families,

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins. Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins.

RAD51 interacts with SUMO-1 through its SIM

Phosphopeptides identified harboring minimal binding motifs

Selectivity-determining regions

Schematic representation of the hydrolysis of amorphous and microcrystalline cellulose by noncomplexed (A) and complexed (B) cellulase systems. Schematic.

Excerpt from the Hsp70 sequence alignment showing some of the important sequence signatures (boxed regions) distinguishing eukaryotic nuclear-cytosolic.

Structure of the Xist gene.

T4P gene clusters in C. perfringens and C. difficile.

Molecular models for module exchange between phages.

Structural features of seven streptococcal cell surface proteins that function in adherence and colonization. Structural features of seven streptococcal.

Conserved motifs in the ABC

Simple insertions and cointegrate formation.

Domain structure of TLR2 (A) and Nod2 (B).

Volume 97, Issue 6, Pages (June 1999)

Characterization of CWR22 xenografts and XMRV-related sequences.

Schematics of PilB assembly ATPases.

Alignment of PilT retraction ATPases.

IS200 complex. IS200 complex. (A) Organization of IS200. Short IRs (open arrows) are shown at the left end, and the relative position of the potential.

Organization of a typical IS

IF2 and structural homologues.

Amino acid sequence similarity among C

Sequence alignment of colicin lysis proteins.

TolA, TolB, and Pal crystal structures.

16S rRNA-based phylogeny of sponge-associated cyanobacteria and chloroplasts. 16S rRNA-based phylogeny of sponge-associated cyanobacteria and chloroplasts.

Amino acid substitutions in SHV ESBL derivatives.

Presentation transcript:

DDE consensus of different families. DDE consensus of different families. The alignments are derived from the groups presented in Table 1. Amino acids forming part of the conserved motif are shown as large bold letters. Capital letters indicate conservation within a family, and lowercase letters indicate that the particular amino acid is predominant. The numbers in parentheses show the distance in amino acids between the amino acids of the conserved motif. The retroviral integrase alignment is based on reference 266. The IS3 family is divided into the subgroups IS407, IS2, IS3, IS51, and IS150, as shown in Fig. 7B. The overall alignment (not shown) is essentially that obtained in reference266. For IS21, see also reference129; for mariner, see also references87 and 295; for IS630, see also reference 87; for IS4 and IS5, see also reference 288. The IS5 family is divided into subgroups IS903, IS427, ISL3, IS1031, and IS5, as shown in Fig. 10. For IS256, see references 63 and 260. N2, N3, and C1 are regions defined in the IS4 transposon family (288). Jacques Mahillon, and Michael Chandler Microbiol. Mol. Biol. Rev. 1998; doi: