Amino acid sequence of antigenic fragments 52/3 and UL57/3 of pUL44 and pUL57, respectively, and sequence comparison by dot plot analysis. Amino acid sequence.

Slides:

Advertisements

Similar presentations

Sequence Similarity Searching Class 4 March 2010.

Advertisements

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Comparison of Exemplars of Rotamer Clusters Across the Proteinogenic Amino Acids

Sensitivity, specificity, positive predictive value, and negative predictive value for the different cutoffs used. Sensitivity, specificity, positive predictive.

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

by Parisa Asvadi, Zohra Ahmadi, and Beng H. Chong

Fig. 3. Structure of ALS-associated RNA binding proteins.

Autoradiographs of cDNA gene array of regulatory genes from untreated control (column A) and quercetin-treated (column B) cells. Autoradiographs of cDNA.

Effect of quercetin on colony-forming abilities of prostate cancer cell lines with different aggressive potentials. Effect of quercetin on colony-forming.

Volume 6, Issue 6, Pages (December 2000)

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

Prion-like Domains Program Ewing’s Sarcoma

Effect of OPN on apoptosis of DCs

Ex vivo IL-6 production. Ex vivo IL-6 production. Human whole blood was stimulated with the indicated doses of the E. coli O113 endotoxin that was used.

Amino acid alignment of TprK showing six different sequences in the T

Flow cytometry analysis of TNF-β- and IL-10-producing CD33+ cells.

Volume 84, Issue 3, Pages (February 1996)

Hematological alterations after endotoxin injection.

Kinetics of CXC chemokine appearance after endotoxin injection.

Profiles of anti-inflammatory cytokines after endotoxin injection.

Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Protein sequence alignments for the BcfD (A) and StfH (B) allelic.

Localization of putative cholesterol-binding motifs in the homology model of human glucose transporter 1 (GLUT1) protein. Localization of putative cholesterol-binding.

Effects of E. coli and S. aureus infection on levels of TNF-α and IL-1β in milk. Effects of E. coli and S. aureus infection on levels of TNF-α and IL-1β.

(A) CDK2 and p53 gene expression levels, as quantitated by real-time quantitative PCR with SYBR Green master mix (Stratagene, La Jolla, Calif.). (A) CDK2.

Identification of the GCS1 ortholog in Gonium pectorale.

Phylogenetic analysis and amino acid sequences comparison of HO endonucleases. Phylogenetic analysis and amino acid sequences comparison of HO endonucleases.

Yellow jacket venom allergens, hyaluronidase and phospholipase: Sequence similarity and antigenic cross-reactivity with their hornet and wasp homologs.

Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.

PCR amplification of the ORF encoding the cytosolic p36 protein of M

Fig. 4. transparent encodes Mpv17.(A) tra maps to chromosome 20.

Amino acid sequence deduced from the sequence of contig 131 of G

(A) yellow cDNA comparison among wild-type and ch mutants

Amino acid sequence homology between XLMO-2 and the mouse, human and zebrafish homologs. Amino acid sequence homology between XLMO-2 and the mouse, human.

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Detection of neoantigen-specific T cell recognition in cancer.

Sensitivity and specificity plots of human epididymis protein 4 (HE4) (A and B, respectively) and carbohydrate antigen 125 (CA-125) (C and D, respectively)

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

Structural features of Rps26a.

Sequence comparisons of fungal HOG1 orthologues.

IL-6 production with increasing doses of endotoxin.

Intracellular TNF-α and IL-4 expression in gated CD33+ monocytes by three-color flow cytometry. Intracellular TNF-α and IL-4 expression in gated CD33+

The NTP increases tyrosine phosphorylation of PLC-γ1.

KIT mutations in GISTs. A, amino acid sequence of KIT exon 11 mutations in clinical GIST biopsies. –, amino acids that are deleted; italicized amino acids,

Predicted Amino Acid Sequence of the Tomato Cf-4 Protein (Thomas et al

Schematic representation of the reactivities of IgM antibodies induced against Gly-Ala repeats of EBNA-1 and against glycine-rich motifs of HCMV antigens,

Comparison of OPN production by mature DCs and activated macrophages.

Reactivity of the anti-p36 MAbs against whole M

Effects of intramammary infection with E. coli or S

Flow cytometry analysis of intracellular cytokine expression in control PBMC (left set of panels) and following either PMA-ionomycin activation (middle.

Representative cytokine and cytotoxicity responses to CMV peptides on day 0 and day 7 in one HLA A2+ donor. Representative cytokine and cytotoxicity responses.

Structural features of seven streptococcal cell surface proteins that function in adherence and colonization. Structural features of seven streptococcal.

Structures of wild-type and mutated recombinant CDX2.

Effect of HL60 cell age (expressed in cell passage) on opsonophagocytic activity. Effect of HL60 cell age (expressed in cell passage) on opsonophagocytic.

IgM-specific immunoblot analysis of different HCMV recombinant antigens with a selected serum sample from an HCMV-seronegative patient with acute EBV-induced.

Microcolonies of S. pneumoniae serotype 6B on a Todd-Hewitt agar-yeast extract plate with an overlay containing TTC and antibiotic after 18 h of incubation.

Dot plot comparison of EBNA-1 with recombinant antigens 52/3 (aa 297 to 433 of pUL44) and UL57/3 (aa 545 to 601 of pUL57) of HCMV, containing glycine-rich.

DTH responses to multiple components of the ID93 fusion protein.

Effects of intramammary infection with E. coli or S

Flow cytometric gating strategy used to identify CD69 surface expression on CD4 (left paired columns) and CD8 (right paired columns) T lymphocytes. Flow.

Distributions of levels of antibodies to periodontal pathogens and plasma vitamin C concentrations. Distributions of levels of antibodies to periodontal.

Quantitation of apoptosis in M. aviumsubsp

Amino acid sequence similarity among C

Immunoblot of scFv antibody detected with an anti-FLAG antibody.

OPN production by immature DCs and mature DCs treated with PAMPs

Distribution of responses to vaccine antigens in the culture-positive individual group and the control group. Distribution of responses to vaccine antigens.

Mean reciprocal IFA titer results for serum samples from experimentally vaccinated animals. Mean reciprocal IFA titer results for serum samples from experimentally.

The NTP inhibits the AFC response to SRBC

Indirect immunofluorescence reactions on primate smooth muscle tissue for EMA detection depicting the following: (A) prozone reactions at low dilution.

Surface CD4 and CD14 and intracellular TNF-α expression in PBMCs

Presentation transcript:

Amino acid sequence of antigenic fragments 52/3 and UL57/3 of pUL44 and pUL57, respectively, and sequence comparison by dot plot analysis. Amino acid sequence of antigenic fragments 52/3 and UL57/3 of pUL44 and pUL57, respectively, and sequence comparison by dot plot analysis. Amino acids with respect to pUL44 (p52) and pUL57 contained in recombinant antigens 52/3 and UL57/3 are given in brackets. Numbers indicate amino acid positions with respect to recombinant proteins. (A) Amino acid sequence of the carboxy-terminal part of p52 (pUL44) and the internal portion of pUL57 in HCMV recombinant antigens. Glycine-rich motifs GL, GS, GA, and GR are depicted by boxes. (B) Dot-plot comparison of 52/3 and UL57/3 using the program DNASTAR Lasergene (similarity, 70%; window, 10). Shading of graphs indicates the level of homology. Dieter Lang et al. Clin. Diagn. Lab. Immunol. 2001; doi:10.1128/CDLI.8.4.747-756.2001