Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Slides:

Advertisements

Similar presentations

MVKFLFSVIILFFLLSAVGSSARNIEEDGVIRLPSEVKDFINGKNIDDDSVGGTRWAVLI 60 AGSSGYWNYRHQADVCHAYQVLKRGGVKDENIVVFMYDDIALNEENPRPGVIINHPKGED 120 VYAGVPKDYTGRDVTAHNFYSVLLGNKTAVKGGSGKVIDSGPNDHIFIYYSDHGGPGVLG.

Advertisements

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

Phylogenetic analysis of CADs and oxidoreductases involved in specialized metabolism (ORSMs). Phylogenetic analysis of CADs and oxidoreductases involved.

Conservation of Structure and Mechanism between Eukaryotic Topoisomerase I and Site-Specific Recombinases Chonghui Cheng, Paul Kussie, Nikola Pavletich,

Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,

Sequence alignment of C-terminal phosphorylated plant aquaporins

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

Multiple sequence alignment and analysis of SOFL proteins.

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

Phylogenetic Relationships and Expression Pattern of ZmbZIP22.

Kristopher Josephson, Naomi J. Logsdon, Mark R. Walter Immunity

The 130-bp key region of the promoter of TsVP1 is a direct binding target of TsNAC1. The 130-bp key region of the promoter of TsVP1 is a direct binding.

Volume 5, Issue 1, Pages (January 1997)

Phosphopeptides identified harboring minimal binding motifs

Volume 99, Issue 1, Pages (October 1999)

Gene structures, positions of mutations, and protein domains of PRP18 paralogs in Arabidopsis. Gene structures, positions of mutations, and protein domains.

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

STAT Genes Found in C. elegans

Volume 13, Issue 4, Pages (April 2005)

N-terminal extension of a gene using peptides mapping upstream to an annotated start site. N-terminal extension of a gene using peptides mapping upstream.

Moosa Mohammadi, Joseph Schlessinger, Stevan R Hubbard Cell

Sequence alignment of PHCCEx domains with secondary structure elements of the Tiam2 PHCCEx domain at the top. Sequence alignment of PHCCEx domains with.

Prediction of Plant MicroRNA Targets

Two Structures of Cyclophilin 40

Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Protein sequence alignments for the BcfD (A) and StfH (B) allelic.

Crystal Structure of a Phosphoinositide Phosphatase, MTMR2

What Does It Take to Bind CAR?

Volume 15, Issue 6, Pages (December 2001)

Expression of the AREB1 Gene and Subcellular Localization of the AREB1 Protein.(A) Structure of AREB1 family proteins. Expression of the AREB1 Gene and.

The Active Conformation of the PAK1 Kinase Domain

Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development K. Kosaki,

Identification of the GCS1 ortholog in Gonium pectorale.

Correction of Gene Annotation and Other Sequence Analysis of Arabidopsis Proteins Identified on the 2-D Gels in Figure 1.(A) Spot 71, identified as a 17.2-kD.

Figure 1 Pedigree and genetic findings

Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.

Two cycad AOX genes, CrAOX1 and CrAOX2, showing different expression patterns in thermogenic male cones. Two cycad AOX genes, CrAOX1 and CrAOX2, showing.

Structure and Dynamics of Zymogen Human Blood Coagulation Factor X

The RC4 Domain of PbrS-RNase Is Critical for Interaction with PbrActin1. The RC4 Domain of PbrS-RNase Is Critical for Interaction with PbrActin1. (A) Dissection.

PfSec13 is a structural homolog of ScSec13·Nup145C.

(A) Deduced amino acid sequence of the D2SV cDNA cloned from the mouse heart RNA. The novel 20 amino acid C-terminus (CT) is underlined. (A) Deduced amino.

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Schematic representation of the domain structures of insect enzymes involved in chitin metabolism. Schematic representation of the domain structures of.

Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

(A) Segregation of mutations in TMEM231 in JBTS families.

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins. Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins.

RAD51 interacts with SUMO-1 through its SIM

Phosphopeptides identified harboring minimal binding motifs

Comparison of the sequences of Fzo/Mfn and structure of mammalian Mfn2

Conservation of key sequence features and endocytic localisation in TbCALM. Conservation of key sequence features and endocytic localisation in TbCALM.

Kristopher Josephson, Naomi J. Logsdon, Mark R. Walter Immunity

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

Structural insights based on chimeric Alp4-GCP2 analysis.

Figure 2 Compound heterozygous mutations in ADAM22

Phylogenetic analysis and domain structure of CALM proteins.

Three protein kinase structures define a common motif

Selectivity-determining regions

Alexandre Irrthum, Marika J

Genomic Sequence of Ufo1-1 Reveals a Novel CACTA Transposon Insertion in the Candidate Gene. Genomic Sequence of Ufo1-1 Reveals a Novel CACTA Transposon.

KIT mutations in GISTs. A, amino acid sequence of KIT exon 11 mutations in clinical GIST biopsies. –, amino acids that are deleted; italicized amino acids,

Predicted Amino Acid Sequence of the Tomato Cf-4 Protein (Thomas et al

Domain analysis of GmPHD6 binding to LHP1, DNA element, and histone H3

Conserved motifs in the ABC

Looking at periodicity in protein sequence and structure

Predicted pathogenic BRCA1 amino acid substitutions are confined to the evolutionarily conserved N- and C-terminal domains. Predicted pathogenic BRCA1.

Topology of human Cx26 and Cx43 indicating crucial domains as well as peptides that affect protein and channel functions. Topology of human Cx26 and Cx43.

SDS-PAGE and Coomassie Blue Staining of Protein Samples after Various Purification Steps of Both Rice and Barley ADPG Hydrolytic NPPs.Lane numbering of.

S. moellendorffii BBI3 Is Predicted to Be a BBI Based on Sequence Similarity at the Inhibitory Motifs and Shared Primary Protein Architecture. S. moellendorffii.

Sequence alignment of colicin lysis proteins.

Presentation transcript:

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using the ClustalX algorithm. Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using the ClustalX algorithm. Identical amino acids are shaded in black boxes. Abbreviations are provided in the Methods. The red bar represents the P-loop domain conserved in PR10/Bet v1 family proteins. Red circles correspond to the Tyr, Lys, Asp, and Glu residues that form the catalytic site of Tf NCS (Ilari et al., 2009). Eun-Jeong Lee, and Peter Facchini Plant Cell 2010;22:3489-3503 ©2010 by American Society of Plant Biologists