Rama Balakrishnan AmiGO Tutorial Saccharomyces Genome Database (SGD) Stanford University.

Slides:

Advertisements

Similar presentations

BiodiversityCatalogue How-Tos Robert Haines. BiodiversityCatalogue Home Hover over the ‘s for more information!

Advertisements

The Rice Functional Genomics Program of China cDNA microarray database (RIFGP-CDMD) consists of complete datasets, including the probe sequences, microarray.

Rama Balakrishnan Saccharomyces Genome Database Stanford University

1 Welcome to the Protein Database Tutorial This tutorial will describe how to navigate the section of Gramene that provides collective information on proteins.

Collaboration with IntAct and InterMine: SGD Rama Balakrishnan Saccharomyces Genome Database Gene Ontology Consortium Stanford University, CA USA.

MainLabMeeting_PingZheng_ Ran the fgenesh on the large contigs from the matina_1_6_RNA dataset and performed BLAST the Putative genes against.

Encyclopedia of Genetics, Genomics, Proteomics and Bioinformatics USC School of Medicine Library.

Biological Databases Notes adapted from lecture notes of Dr. Larry Hunter at the University of Colorado.

Ontology Annotation Treebrowser tool (OAT) Getting started.

Ontology Annotation Tree browser tool (OAT) Getting started.

Genome Browsing with the UCSC Genome Browser

Toward Making Online Biological Data Machine Understandable Cui Tao Data Extraction Research Group Department of Computer Science, Brigham Young University,

An introduction to using the AmiGO Gene Ontology tool.

Using 3D-SURFER. Before you start 3D-Surfer can be accessed at For visualization.

Aequatus Browser, an open-source web-based tool developed at TGAC to visualise homologous gene structures among differing species or subtypes of a common.

Viewing & Getting GO COST Functional Modeling Workshop April, Helsinki.

1 Welcome to the Quantitative Trait Loci (QTL) Tutorial This tutorial will describe how to navigate the section of Gramene that provides information on.

Gramene Objectives Develop a database and tools to store, visualize and analyze data on genetics, genomics, proteomics, and biochemistry of grass plants.

1 Welcome to the GrameneMart Tutorial A tool for batch data sequence retrieval 1.Select a Gramene dataset to search against. 2.Add filters to the dataset.

The aims of the Gene Ontology project are threefold: - to compile vocabularies to describe components, functions and processes - to produce tools to query.

VT SMS System User Manual

SAGExplore web server tutorial for Module II: Genome Mapping.

TGAC Browser A new open-source client-side rendering genomic browse

Regulatory Genomics Lab Saurabh Sinha Regulatory Genomics Lab v1 | Saurabh Sinha1 Powerpoint by Casey Hanson.

Copyright OpenHelix. No use or reproduction without express written consent1.

Grup.bio.unipd.it CRIBI Genomics group Erika Feltrin PhD student in Biotechnology 6 months at EBI.

SAGExplore web server tutorial for Module I: Genome Explore.

The generic Genome Browser (GBrowse) A combination database and interactive web page for manipulating and displaying annotations on genomes Developed by.

Production Priorities. Genome protein sets User Support Production systems change Database changes On-the-fly species gene associations.

Comparing DNA Sequences to Understand Evolutionary Relationships with BLAST INVESTIGATION 3 BIG IDEA 1.

Copyright OpenHelix. No use or reproduction without express written consent1.

POC tutorial#4: POC website and Browser This tutorial will run automatically in Quicktime. To run the tutorial at your own pace use the internal controllers.

From Tech Support with love Susan, Luisa and Nick.

Regulatory Genomics Lab Saurabh Sinha Regulatory Genomics | Saurabh Sinha | PowerPoint by Casey Hanson.

I NTRODUCTION TO DATABASES - P RACTICAL. Q UERY S EQUENCE >my weird new protein MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT.

This tutorial will describe how to navigate the section of Gramene that provides descriptions of alleles associated with morphological, developmental,

Copyright OpenHelix. No use or reproduction without express written consent1.

Copyright OpenHelix. No use or reproduction without express written consent1.

SAGExplore web server tutorial. The SAGExplore server has three different modules …

What do we already know ? The rice disease resistance gene Pi-ta Genetically mapped to chromosome 12 Rybka et al. (1997). It has also been sequenced Bryan.

Welcome to Gramene’s RiceCyc (Pathways) Tutorial RiceCyc allows biochemical pathways to be analyzed and visualized. This tutorial has been developed for.

Tools in Bioinformatics Genome Browsers. Retrieving genomic information Previous lesson(s): annotation-based perspective of search/data Today: genomic-based.

Supplementary Figure S1. Supplementary Figure S2.

Complete Ordering System for Promotional Literature and Samples Quick Reference and Training Guide.

Welcome to the GrameneMart Tutorial A tool for batch data sequence retrieval 1.Select a Gramene dataset to search against. 2.Add filters to the dataset.

Welcome to the Protein Database Tutorial. This tutorial will describe how to navigate the section of Gramene that provides collective information on proteins.

The Bovine Genome Database Abstract The Bovine Genome Database (BGD, facilitates the integration of bovine genomic data. BGD is.

Welcome We will be showing you how to change your Banner Web Pin through the Portal. Please note that since the implementation of the Portal, that changing.

Bioinformatics What is a genome? How are databases used? What is a phylogentic tree?

Getting GO annotation for your dataset

Journal of Mountain Science

INVESTIGATION 3 BIG IDEA 1

SAGExplore web server tutorial for Module III:

ECDB (ENDOMETRIAL CANCER GENE DATABASE)

Saccharomyces Genome Database (SGD)

Department of Genetics • Stanford University School of Medicine

INVESTIGATION 3 BIG IDEA 1

INVESTIGATION 3 BIG IDEA 1

User Manual KC SMS System User Manual

Welcome to the Protein Database Tutorial

A database of Cross-border Regulation of microRNAs Shu xin

Welcome to the Quantitative Trait Loci (QTL) Tutorial

Welcome to the Markers Database Tutorial

Gramene’s Ontologies Tutorial

INVESTIGATION 3 BIG IDEA 1

Multiple sequence alignment & Phylogenetics Analysis

Welcome to the GrameneMart Tutorial

About CGD/ Getting Started

Welcome - webinar instructions

Presentation transcript:

Rama Balakrishnan AmiGO Tutorial Saccharomyces Genome Database (SGD) Stanford University

What is AmiGO? Web application that reads from the GO Database (mySQL) Allows to –browse the ontologies –view annotations from various species –compare sequences using BLAST (GOst) Ontologies are loaded into the database from the gene_ontology.obo file Annotations are loaded from the gene_association files submitted by the various annotating groups –Only ‘Non-IEA’ annotations are loaded

AmiGO

Basic Search

More on term search results

Term Details Page

Gene Product Details and Annotations

Browsing the Ontologies Is_a relationship Part_of relationship Leaf node or no children Node has been opened, can be clicked to close Node has children, can be clicked to view children pie chart summary of the numbers of gene products associated to any immediate descendants of this term in the tree.

Annotations associated with a term Annotation data are from the gene_associations file submitted by the annotating groups

Advanced search

Filters

GOST-Gene Ontology blaST Blast a protein sequence against all gene products that have a GO annotation Can be accessed from the AmiGO Home page (front page)

GOst can also be accessed from the annotations section

AmiGO Help

Contact us We welcome your input Please send suggestions, bugs to us