Chapter 4.3: Protein Tertiary and Quaternary Structures CHEM 7784 Biochemistry Professor Bensley.

Slides:

Advertisements

Similar presentations

Structure of Proteins 3D structure determined by amino acid sequence Structure - Function Native structure of a protein = functionally, folded conformation.

Advertisements

Tertiary Structure of Proteins The tertiary structure defines the specific overall 3-D shape of the protein Tertiary structure is based on various types.

PROTEINS Proteins are the most complex and most diverse group of biological compounds. If you weigh about 70 kg: About 50 of your 70 kg is water. Many.

Chemistry: An Introduction to General, Organic, and Biological Chemistry, Twelfth Edition© 2015 Pearson Education, Inc Proteins: Secondary, Tertiary,

Chapter 16 Amino Acids, Proteins, and Enzymes

General, Organic, and Biological Chemistry Copyright © 2010 Pearson Education, Inc.1 Chapter 19 Amino Acids and Proteins 19.4 Protein Structure: Primary.

Protein structure and folding Some facts and fundamental conepts Cherri Hsu Institute of Chemistry B307

Secondary structure elements  helices  strands/sheets/barrels  turns The type of 2° structure is determined by the amino acid sequence –Chemical & physical.

19.6 Primary Structure The primary structure of a protein is the sequence of amino acids in the peptide chain Protein backbone Ala-Leu-Cys-Met.

Chapter 4: Part 2 Protein 3-D structure: 3 o and 4 o structure and protein folding.

Chemical and physical features of proteins.

How does the cell manufacture these magnificent machines? Proteins, that is…

1. Primary Structure: Polypeptide chain Polypeptide chain Amino acid monomers Peptide linkages Figure 3.6 The Four Levels of Protein Structure.

Homework for next week Green q 1,2,3 p29 Do evaluation points from Biuret Practical Revise test on all work next week Bring evidence you have revised please.

Proteins – p. 25

Homework 1.Make a table to contrast the features of fibrous and globular proteins (see next slide) 2.Worksheet protein structure and carbohydrate questions.

Lesson 5.  Explain the term secondary structure  Explain the term tertiary structure.

Proteins Dr. Sumbul Fatma Clinical Chemistry Unit

Major Organic Molecules. Carbohydrates Includes both sugars and their polymers. Polymer building blocks: simple sugars called monosaccharides General.

© 2012 Pearson Education, Inc. Lectures by Kathleen Fitzpatrick Simon Fraser University Chapter 3 The Macromolecules of the Cell- Modified by Dr. Jordan-

7.5: PROTEINS Proteins Function Structure. Function 7.5.4: State four functions of proteins, giving a named example of each. [Obj. 1] Proteins are the.

Introduction to Protein Structure

Proteins. Proteins? What is its How does it How is its How does it How is it Where is it What are its.

STRUCTURAL ORGANIZATION

BRANDI AND ZAK. Secondary Structure Can fold and align them selves and the repeating pattern is called a secondary structure. Common structures are the.

Proteins Amino acids, peptide bonds, primary, secondary, tertiary and quaternary structures.

7.4/14.1 PROTEINS. Protein’s have 4 levels of Structure: 1. Primary Structure = the order of amino acids that make up the polypeptide; amino acids are.

Text, Figure 6-14 Examples of two kinds of ‘  -turns’ in proteins Geometric details are not so important for our discussions. One point to note however.

Operone lac Principles of protein structure and function Function is derived from structure Structure is derived from amino acid sequence Different.

Protein Structure (Foundation Block) What are proteins? Four levels of structure (primary, secondary, tertiary, quaternary) Protein folding and stability.

Protein structure and function Part - I

CHAPTER 4 Proteins: Structure, Function, Folding –Structure and properties of the peptide bond –Structural hierarchy in proteins –Structure and function.

Protein Structure (Foundation Block) What are proteins? Four levels of structure (primary, secondary, tertiary, quaternary) Protein folding and stability.

1 Chapter Outline 13.1 Amino Acid Structures - General structure of the aa; Groups bonded to the alpha carbon; structure of aa in water; zwitterion - Classification.

Proteins Polymers of amino acid monomers DO NOW: What do you notice about the proteins below?

Proteins… Let’s Review…… then….. Let’s discover proteins…. PollEv.com/tinalambiase209.

Primary structure. Proteins Proteins contain Carbon (C), Hydrogen (H), Oxygen, Nitrogen (N) and sometimes Sulphur (S) The monomer units of proteins are.

 Protein structure is complex and can be divided into four levels.  1. Primary structure = the sequence of amino acids in a polypeptide chain ◦ Genes.

Sections 14.9, 14.10, 14.11, and Hannah Nowell and Jenny Sulouff.

Chapter Proteins: Secondary, Tertiary, Quaternary, and Denaturation.

Denaturation of proteins Some of the interactions responsible for holding a protein in its 3D tertiary structure are weak –Eg hydrogen bonds They are easily.

This diagram shows the primary structure of PIG INSULIN, a protein hormone as discovered by Frederick Sanger. He was given a Nobel prize in The primary.

Protein Structure.

Chemistry: An Introduction to General, Organic, and Biological Chemistry, Eleventh Edition Copyright © 2012 by Pearson Education, Inc. Chapter 16 Amino.

3S: Proteins Shireen Rudina. What do proteins do? Structure – Collagen in skin, keratin in hair and nails Signaling between cells Defend against disease.

Proteins Structures and Functions. What? A series of amino acids in a polypeptide chain Produced from the coding in the DNA of the nucleus Makes up.

© SSER Ltd.. Proteins are huge three-dimensional molecules whose building blocks or monomers are the variety of different amino acids found in nature.

Proteins Proteins are the building materials for the body.

Proteins: Secondary, Tertiary, Quaternary, and Denaturation

Protein Proteins are found throughout living organisms.

Proteins What do we need proteins for?

Protein Structure.

(4) Genes and proteins in health and disease

Proteins… Let’s Review…… then….. Let’s discover proteins….

Protein Structure and Examples

Protein Structure Chapter 14.

FIBROUS & GLOBULAR PROTEINS

Protein 3-Dimensional Structure and Function

Protein Structure and Examples

The Three-Dimensional Structure of Proteins

Presentation transcript:

Chapter 4.3: Protein Tertiary and Quaternary Structures CHEM 7784 Biochemistry Professor Bensley

CHAPTER 4.3 Proteins: Tertiary and Quaternary Structures –The structural hierarchy in proteins (tertiary and quaternary structures) –The structure and function of fibrous proteins –The structural analysis of globular proteins Today’s Objectives - To learn and understand:

Quiz Question 23 Fibrous proteins differ from globular proteins in that: a)fibrous proteins tend to serve structural functions, and globular proteins are more likely to be enzymes. b) fibrous proteins can often contain several types of secondary structure, whereas globular proteins usually consist largely of a single type of secondary structure. c) globular proteins are insoluble in water, and fibrous proteins are usually soluble. d) globular proteins are more likely than fibrous proteins to have an elaborate quaternary structure.

Tertiary structure refers to the overall spatial arrangement of atoms in a polypeptide chain or in a protein Two major classes: – fibrous proteins –globular proteins Protein Tertiary Structure

Proteins with similar 1 o structure also have similar 3 o structure tuna 1 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWN yeast 1 GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVWDE rice 1 GNPKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTANKMAVIWEE tuna 61 ETLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS yeast 61 NNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKACE rice 61 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLISYLKEATS

Fibrous Proteins: From Structure to Function Function Structure Example Tough, rigid,Cross-linked  -helixes  -keratin hard (nails, horns)Rigid linker (S—S) Tensile strength,Cross-linked triple-helixes Collagen non-stretchingFlexible linker (Lys-HyLys) (tendons, cartilage) Soft, flexibleNon-covalently held  -sheets non-stretchyvan der Waals interactionSilk fibroin (egg sac, nest, web)

Structure of  -Keratin in Hair

Structure of Collagen

Collagen Fibrils

Silk Fibroin

Motifs (folds) Arrangements of several secondary structure elements

Motifs Combine to form Domains Alpha/beta barrel Parallel twisted sheet

Quaternary Structure Quaternary structure is formed by spontaneous assembly of individual polypeptides into a larger functional cluster

Protein Structure Methods: X-Ray Crystallography

Protein Structure Methods: Biomolecular NMR