The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester

Slides:

Advertisements

Similar presentations

Using Ontology Reasoning to Classify Protein Phosphatases K.Wolstencroft, P.Lord, L.tabernero, A.brass, R.stevens University of Manchester.

Advertisements

Creating and Managing Sites Module 7. Overview Creating Standard Sites Customizing Look and Feel Saving Sites as Templates.

NO YES Question 3 Question 2 Question 1 Topic 1 Next Topic 1.

What features should a retailer promote in its ads for national branded products? Are these the same features that should be promoted by the retailer for.

XCON - IETF 62 (March 2005) - Minneapolis 1 XCON data modeling – NETCONF, RDF and others draft-schulzrinne-sipping-emergency-req-01 draft-sipping-sos Henning.

Yii – How Power Comes Introduction, OOP & Design Patterns Presented at: Nextbridge Multan Center Aug 25, 2011.

UNIT spelling SOFT C – HARD C.

System Design and Memory Limits. Problem  If you were integrating a feed of end of day stock price information (open, high, low, and closing price) for.

Slovak University of Technology Department of Computer Science and Engineering Bratislava, Slovakia Pavol Návrat, Mária Bieliková {navrat,

Chang WangChang Wang, Sridhar mahadevanSridhar mahadevan.

Old Dog Consulting PCEP - A Protocol for All Uses? How and when to extend an existing protocol Adrian Farrel Old Dog Consulting

ML ALGORITHMS. Algorithm Types Classification (supervised) Given -> A set of classified examples “instances” Produce -> A way of classifying new examples.

Miscellaney. Administrivia Reminder: meeting scheduling For P3, the milestones are in-person meetings, not just “send Terran a ball of stuff” (Though.

SEWEBAR - a Framework for Creating and Dissemination of Analytical Reports from Data Mining Jan Rauch, Milan Šimůnek University of Economics, Prague, Czech.

FreeBMD and how to use it A short walk with Val through one of her favourite websites.

Mango Language Learning Software: a new eResource Alison McMillan Technology Assistant – Marigold Library System.

DANGEROUSPRODUCTSHAVE TOBENOTIFIED ! BUSINESS APPLICATION DANGEROUS PRODUCTS HAVE TO BE NOTIFIED! adam romanowski European Commission Health & Consumer.

1 st Grade Science.  After being shown features of the day and night time sky, the students will be able to draw detailed pictures of the day and night.

UNDERGRADUATE PROGRAMS AT STEVENS HENAGER COLLEGE.

Course Management Systems (CMS) Presented by: Jeff Lewis Design by: Ben Zastrocky Director, Web & Instructional Technology.

Deciding Semantic Matching of Stateless Services Duncan Hull †, Evgeny Zolin †, Andrey Bovykin ‡, Ian Horrocks †, Ulrike Sattler † and Robert Stevens †

CS426 Game Programming II Dan Fleck. Why games?  While the ideas in this course are demonstrated programming games, they are useful in all parts of computer.

Taverna in e-Lico  e-Lico is an EU Project ( ) to create a virtual laboratory for data mining and data-intensive sciences  Main partners: –University.

COMP 171: Principles of Computer Science I John Barr.

Question You understand your core business, but are you comfortable with the other elements needed to run a successful business? For instance,  Sales.

Permission-based Malware Detection in Android Devices REU fellow: Nadeen Saleh 1, Faculty mentor: Dr. Wenjia Li 2 Affiliation: 1. Florida Atlantic University,

University of Windsor School of Computer Science Topics in Artificial Intelligence Fall

Neev Technologies - Confidential 2010 Service Offering – NeevCloudLoad Cloud Based Load Testing Solution.

1- Logic Programming with Prolog AI.....(A.Abeer Alshihri)1.

Using Out of the Box Web Parts 3 | SharePoint Saturday.

WP2: ONTOLOGY ENRICHMENT METHODOLOGIES Carole Goble (IMG) Robert Stevens (BHIG) Mikel Egaña Aranguren (BHIG) Manchester University Computer Science: IMG:

Nick Bristow Innovation and Accessibility at 18f.

Semantic Web BY: Josh Rachner and Julio Pena. What is the Semantic Web? The semantic web is a part of the world wide web that allows data to be better.

Symbolism THE SCARLET LETTER. CHARACTERS Hester symbolizes human nature Dimmesdale symbolizes hypocrisy Pearl symbolizes the scarlet letter Chillingworth.

The life cycle of a plant.

SYNTHESIS An information system for administration documentation and promotion of cultural instances Center for Cultural Informatics Foundation for Research.

BioHealth Informatics Group Advanced OWL Tutorial 2005 Design Patterns Robert Stevens.

Holiday Gratitude: For What and Whom are you Thankful for?

Good Readers Make Predictions  Before, During, and After reading  They start with “I think…”  When you are done, you can revise, or change, your prediction.

Metadata basics and linked data A fast half day with exercises Data with a purpose Understanding data types Identifiers and identities Making a statement.

A Rule Driven Bi-Directional Translation System for Remapping Queries and Result Sets Between a Mediated Schema and Heterogeneous Data Sources R. Shaker.

Consider the machine learning problem in the figure below (only four examples of each class are shown for simplicity, imagine that we have 1,000 examples.

HARRIS COUNTY WATERSHED PROTECTION GROUP Lessons Learned on Storm Water Quality Research Projects Presented by: Trent Martin July 15, 2008.

Taverna, myExperiment and HELIO services Anja Le Blanc Stian Soiland-Reyes Alan Willams University of Manchester.

Hello scientists! In the past your school has helped me solve many a problem. Now I have a new one for you! Could you could get your heads together and.

The Bio-Health Informatics Group Andy Brass – Robert Stevens –

TIME MANAGEMENT SOFTWARE  Time Management Software manages your time properly and your business to keep running faster. You can manage the project and.

A Reusable Framework for Automated Record Creation and Population

The 15th International Semantic Web Conference Kobe, Japan.

Nonogram Solver Cs491b Software Design Prepared by :

Supporting Computational Science

The friendly G-PBox Graphical User Interface for the VO/Site admins

WIS and GCI/GEOSS interoperability project

Lecture #11: Ontology Engineering Dr. Bhavani Thuraisingham

Science: Year 2 Overview

Backpage Manchester | Manchester classifieds ads !!!!!!

Breathe: Holy Spirit Moving through Me

ريكاوري (بازگشت به حالت اوليه)

برنامه آموزش مديريت زمان در يک هفته مديريت سايت دانشکده کامپيوتر

كار همراه با آسودگي و امنيت

TIME MANAGEMENT مديريت زمان

مديريت موثر جلسات Running a Meeting that Works

ВОМР Подмярка 19.2 Възможности за финансиране

Споразумение за партньорство

Data science online training.

STORE MANAGER RESPONSIBILITIES.

Improving Your Testing

WTF… About the unsecurity of IoT

Presentation transcript:

The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester

Semantic Webs for Life Sciences Pacific Symposium on Biocomputing The creation and use of Semantic Web appliccations

Give me convenience, or give me death

Making the Trains Run on Time

Reinventing the wheel

Heath Robinson

Learning New Tricks

Purity

The Puritan Approach

Angels on the head of a pin

Holy Grail

A ‘Grand Challenge’

Classifying Proteins >uniprot|Q15262|PTPK_HUMAN Receptor-type protein-tyrosine phosphatase kappa precursor (EC ) (R-PTP-kappa). MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSAGGCTFDDGPGACDYHQDLYDDFEWVHV SAQEPHYLPPEMPQGSYMIVDSSDHDPGEKARLQLPTMKENDTHCIDFSYLLYSQKGLNP GTLNILVRVNKGPLANPIWNVTGFTGRDWLRAELAVSSFWPNEYQVIFEAEVSGGRSGYI AIDDIQVLSYPCDKSPHFLRLGDVEVNAGQNATFQCIATGRDAVHNKLWLQRRNGEDIPV……….. InterPro Instance Store Reasoner Translate Codify

Continuous Revolution

KISS & Tell Keep it simple, stupid Keep it simple and stupid Keep it stupid Keep it sufficiently sophisticatedLie about the features