Analysis of Biomolecular Sequences 29/01/2015 Mail: Prof. Neri Niccolai Simone Gardini

Slides:



Advertisements
Similar presentations
Protein structure prediction 29/01/2015 Mail: Prof. Neri Niccolai Simone Gardini
Advertisements

On line (DNA and amino acid) Sequence Information Lecture 7.
Integration of Protein Family, Function, Structure Rich Links to >90 Databases Value-Added Reports for UniProtKB Proteins iProClass Protein Knowledgebase.
1 Welcome to the Protein Database Tutorial This tutorial will describe how to navigate the section of Gramene that provides collective information on proteins.
The design, construction and use of software tools to generate, store, annotate, access and analyse data and information relating to Molecular Biology.
Homework Assignments due next session 1.Find a entry of interest in OMIM ( )
How to use the web for bioinformatics Molecular Technologies Ethan Strauss X 1171
Swiss-Prot Protein Database Daniel Amoruso December 2, 2004 BI 420.
Intro to Bioinformatics Summary. What did we learn Pairwise alignment – Local and Global Alignments When? How ? Tools : for local blast2seq, for global.
Protein Databases EBI – European Bioinformatics Institute
Corrections. N-linked glycosylation (GlcNac): Look at the Swiss-Prot annotation (in a random ‘glycosylated’ entry)
Today’s menu: -UniProt - SwissProt/TrEMBL -PROSITE -Pfam -Gene Onltology Protein and Function Databases Tutorial 7.
Tutorial 5 Motif discovery.
©CMBI 2005 Search tools Google, MRS, SRS. ©CMBI 2004 Search tools SRS = Sequence Retrieval System MRS = Maarten’s Retrieval System Google = Thé best generic.
Today’s menu: -UniProt - SwissProt/TrEMBL -PROSITE -Pfam -Gene Onltology Protein and Function Databases Tutorial 7.
Sequence/Structure Alignment Resources from NCBI Steve Bryant Protein Data Bank Rutgers University November 19, 2005.
EBI is an Outstation of the European Molecular Biology Laboratory. UniProt Jennifer McDowall, Ph.D. Senior InterPro Curator Protein Sequence Database:
UniProt - The Universal Protein Resource
Today’s menu: -UniProt - SwissProt/TrEMBL -PROSITE -Pfam -Gene Onltology Protein and Function Databases Tutorial 7.
Bioinformatics Lecture 3 BCH 550 Arjumand Warsy. Retrieving Protein Sequences.
Protein Sequence Analysis - Overview Raja Mazumder Senior Protein Scientist, PIR Assistant Professor, Department of Biochemistry and Molecular Biology.
Protein structure prediction 29/01/2015 Mail: Prof. Neri Niccolai Simone Gardini
BLAST: Basic Local Alignment Search Tool Urmila Kulkarni-Kale Bioinformatics Centre University of Pune.
Arabidopsis Gene Project GK-12 April Workshop Karolyn Giang and Dr. Mulligan.
Making Sense of DNA and protein sequence analysis tools (course #2) Dave Baumler Genome Center of Wisconsin,
Wellcome Trust Workshop Working with Pathogen Genomes Module 3 Sequence and Protein Analysis (Using web-based tools)
Viewing & Getting GO COST Functional Modeling Workshop April, Helsinki.
Basic Introduction of BLAST Jundi Wang School of Computing CSC691 09/08/2013.
Introduction to databases Tuomas Hätinen. Topics File Formats Databases -Primary structure: UniProt -Tertiary structure: PDB Database integration system.
Semantic Similarity over Gene Ontology for Multi-label Protein Subcellular Localization Shibiao WAN and Man-Wai MAK The Hong Kong Polytechnic University.
Discover the UniProt Blast tool. Murcia, February, 2011Protein Sequence Databases Customize the BLAST results.
UniProt Non-redundant Reference Cluster (UniRef) Databases Swiss Institute of Bioinformatics (SIB) European Bioinformatics Institute (EMBL-EBI)
Workshop OUTLINE Part 1: Introduction and motivation How does BLAST work? Part 2: BLAST programs Sequence databases Work Steps Extract and analyze results.
Corrections. - The cacao genome is currently being sequenced - Human Chromosome 1 sequence Search ‘Genome’
Adding GO GO Workshop 3-6 August GOanna results and GOanna2ga 2. gene association files 3. getting GO for your dataset 4. adding more GO (introduction)
Module 3 Sequence and Protein Analysis (Using web-based tools) Working with Pathogen Genomes - Uruguay 2008.
1 LSM2241 AY0910 Semester 2 MiniProject Briefing Round 5.
Copyright OpenHelix. No use or reproduction without express written consent1.
Clean up sequences with multiple >GI numbers when downloaded from NCBI BLAST website [ Example of one sequence and the duplication clean up for phylo tree.
Protein Sequence Analysis - Overview - NIH Proteomics Workshop 2007 Raja Mazumder Scientific Coordinator, PIR Research Assistant Professor, Department.
Motif discovery and Protein Databases Tutorial 5.
Basic Local Alignment Search Tool BLAST Why Use BLAST?
(PSI-)BLAST & MSA via Max-Planck. Where? (to find homologues) Structural templates- search against the PDB Sequence homologues- search against SwissProt.
EBI is an Outstation of the European Molecular Biology Laboratory. EBI patent related services Jennifer McDowall Senior Scientist, EMBL-EBI 3 rd Annual.
EBI is an Outstation of the European Molecular Biology Laboratory. UniProtKB Sandra Orchard.
Copyright OpenHelix. No use or reproduction without express written consent1.
Getting GO: how to get GO for functional modeling Iowa State Workshop 11 June 2009.
David Wishart February 18th, 2004 Lecture 3 BLAST (c) 2004 CGDN.
Central hub for biological data UniProtKB/Swiss-Prot is a central hub for biological data: over 120 databases are cross-referenced (EMBL/DDBJ/GenBank,
Protein sequence databases Petri Törönen Shamelessly copied from material done by Eija Korpelainen This also includes old material from my thesis
Copyright OpenHelix. No use or reproduction without express written consent1.
Welcome to the combined BLAST and Genome Browser Tutorial.
HANDS-ON ConSurf! Web-Server: The ConSurf webserver.
Summer Bioinformatics Workshop 2008 BLAST Chi-Cheng Lin, Ph.D., Professor Department of Computer Science Winona State University – Rochester Center
Welcome to the Protein Database Tutorial. This tutorial will describe how to navigate the section of Gramene that provides collective information on proteins.
PROTEIN IDENTIFIER IAN ROBERTS JOSEPH INFANTI NICOLE FERRARO.
BLAST: Basic Local Alignment Search Tool Robert (R.J.) Sperazza BLAST is a software used to analyze genetic information It can identify existing genes.
Designing, Executing and Sharing Workflows with Taverna 2.4 Different Service Types Katy Wolstencroft Helen Hulme myGrid University of Manchester.
Research Paper on BioInformatics
EMBL-EBI, programmatically - take a REST from manual searching: Sequence analysis tools Web Production Team Anna Foix Joon Lee.
LSM3241: Bioinformatics and Biocomputing Lecture 4: Sequence analysis methods revisited Prof. Chen Yu Zong Tel:
Genome Center of Wisconsin, UW-Madison
Predicting Active Site Residue Annotations in the Pfam Database
PIR: Protein Information Resource
BLAST.
Protein Sequence Analysis - Overview -
Basic Local Alignment Search Tool
Hands-on: Reviewing BLAST
Basic Local Alignment Search Tool (BLAST)
Multiple sequence alignment & Phylogenetics Analysis
Presentation transcript:

Analysis of Biomolecular Sequences 29/01/2015 Mail: Prof. Neri Niccolai Simone Gardini

Database - UniProtKB UniProtKB consists of two sections: Reviewed (Swiss-Prot, ) - Manually annotated Unreviewed (TrEMBL, ) - Computationally analyzed The UniProt Knowledgebase (UniProtKB) is the central hub for the collection of functional information on proteins, with accurate, consistent and rich annotation. Universal Protein Resource

Database - UniProtKB

hemo_homo.fasta

Database - UniProtKB

1)How many proteins found if you look for Rna Polymerase of Ebola? Questions

Database - UniProtKB 2)Save all sequence in FASTA format into a file (Surname.fasta) Questions

Database - UniProtKB 3)Save one sequence in FASTA format into a file (UniProt ID = Entry, save as UniprotID.fasta) Questions

Database - UniProtKB 4)Which domains found for that protein? (UniProt ID -> NUM) Questions

Database - UniProtKB 5)Title, Author and Year of first article for the protein choice Questions

Tool - BLAST BLAST is a method to ascertain sequence similarity. BLAST is a suite of programs provided by NCBI for aligning query sequences against those present in a selected target database. The results are reported in a form of a ranked list followed by a series of individual sequence alignments, plus various statistics and scores. Two methods for using Blast: 1.Known protein 2.Unknown protein Basic Local Alignment Search Tool

Tool - BLAST 1. Known protein

Tool - BLAST 1. Known protein

Tool - BLAST 1. Known protein

Tool - BLAST 1. Known protein

Tool - BLAST 2. Unknown protein

Tool - BLAST 2. Unknown protein MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQ DASTKKLSCLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFN WGRVVALFYFASKLLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG LLSYFGTPTWQTVTIFVAGV LTASLTIWKKMG

Tool - BLAST 2. Unknown protein

Tool - BLAST 2. Unknown protein

Tool - BLAST 2. Unknown protein Unknown Protein aa

Tool - BLAST 2. Unknown protein

Tool – BLAST from UniProt 1)For this protein using the tool blast A.Q8JPX5B. Q6V1Q2 C. Q )How many known structures found? 3)Write UniProt ID, Name and Organism of the protein with sequence identity lower 4)Save all protein in FASTA format (save as Blast_surname.fasta) Questions

Tool – CLUSTAL OMEGA Save results write your write your title copy and paste the link that arrives on your

Tool – CLUSTAL OMEGA Questions 1)Align all proteins found with UniProt (Rna Pol Ebola) 2)Save results 3)Align all proteins reviewed found with BLAST 4)Save results

Now write the report The report should be sent to Prof. Neri Niccolai : and Simone Gardini :

Feedback: Privacy Policy Feedback
Do Not Sell My Personal Information
About project: SlidePlayer Terms of Service

© 2025 SlidePlayer.com. Inc. All rights reserved.