Abigail Mabe Cell Biology 11-02-03. * All are indicated as diapause-down regulated (all negative values)

Slides:

Advertisements

Similar presentations

Shoot Development A. Function and organization of the apical meristem

Advertisements

1 * egg: generate the system * larva: eat and grow

Notch receptor activation and function. Lz Notch signaling completely changes the way that cells respond to other signaling pathways Flores et al., Cell.

Next lecture: Induction/Signaling Requirements of inducer and responder cells Cascades of inductive events are involved in forming organs Examples of the.

1 * egg: generate the system * larva: eat and grow

Protein Sorting ISAT 351, Spring 2004 College of Integrated Science and Technology James Madison University.

ALZHEIMER'S DISEASE (AD)

Notch1 Transmembrane Receptor Oncogene. What is Notch1?  Transmembrane protein involved in a conserved and simple signaling pathway.

Embryology And Biochemistry. Evidence of Evolution Embryology: the study of how organisms develop  Develop means how the organism changes as it goes.

The Amyloid Precursor Protein, its Functions and Dysfunctions Caitlin “Bio Queen” Mecum Rachael “Handmaiden” Sondeno John “Wiegeabo” Victor Kirk “Keyboard.

Hedgehog signaling pathway Indian hedgehog: expressed in gut and chondrocytes Desert hedgehog: expressed in sertoli cells of the testes Sonic hedgehog:

Vesicular Transport III. N-linked glycosylation because sugar is added to N of asparagine. original precursor oligosaccharide added to most proteins in.

Genome-Wide RNAi Analysis of Growth and Viability in Drosophila Cells Boutros et al.

Sorting Through the Tangles: Alzheimer’s Disease

Alzheimer’s Disease: Genetics, Pathogenesis, Models, and Experimental Therapeutics.

Screening a Library Plate out library on nutrient agar in petri dishes. Up to 50,000 plaques or colonies per plate.

Niemann-Pick Disease Maggie W. George December 5, 2005.

New Cellular Models for Drug Discovery in Alzheimer’s Disease Jordan L. Holtzman, M.D.,Ph.D. 1,2,3 (1) Division of Environmental Health Sciences (2) Departments.

Cystic Fibrosis Hereditary recessive trait disease

Trafficking and processing of APP  -secretase. Intracellular trafficking of APP: relation to its physiological function?

The Amyloid Hypothesis of Alzheimer Pathogenesis APP Amyloid-  production Self-assembly clinical AD neuronal cell death tau.

Chap. 5 Problem 1 Recessive mutations must be present in two copies (homozygous) in diploid organisms to show a phenotype (Fig. 5.2). These mutations show.

Molecular Basis for Relationship between Genotype and Phenotype DNA RNA protein genotype function organism phenotype DNA sequence amino acid sequence transcription.

MiRNA Reading: Lecture notes.

Trafficking and processing of APP  and  -secretase.

Cell Communication Chapter Cell Communication: An Overview  Cells communicate with one another through Direct channels of communication Specific.

The aspartyl protease BACE  -Amyloid cleaving enzyme.

Caroline Goutte The Power of a Genetic Model System: Using Soil Nematodes to Discover Genes Involved in Human Alzheimer’s Disease.

Alzheimer’s Disease and the influence of Presenilin 1 By Tony Cortez.

Genetics and Genomics Forward genetics Reverse genetics

TSC1/Hamartin and Facial Angiofibromas Biology 169 Ann Hau.

Mutations to Aid in Gene Study By: Yvette Medina Cell Phys

FROM GENE TO PROTEIN: TRANSLATION & MUTATIONS Chapter

Alzheimer’s Disease and the influence of Presenilin 1

How do equivalent cells acquire different cell fates?

Material for Introductory Microbiology

Figure 1. Structure of the fly LGR2 gene and the corresponding cDNA sequence. A, Derivation of the fly LGR2 full-length cDNA from the genomic sequence.

General idea and concepts of cell-cell signaling

What does this protein make up or do?

What does this protein make up or do?

Proteins!!! More than just meat.

1 * egg: generate the system * larva: eat and grow

Interactions between Amyloid β-barrel and anionic POPG membrane

General idea and concepts of cell-cell signaling

(T-cell Acute Lymphoblastic Leukemia)

Yee-Ming Chan, Yuh Nung Jan Neuron

Volume 80, Issue 2, Pages (October 2013)

DNA and the Genome Key Area 6a & b Mutations.

Volume 90, Issue 2, Pages (April 2016)

Alzheimer’s Disease and the influence of Presenilin 1

DNA and the Genome Key Area 6a & b Mutations.

Disruption of Axonal Transport and Neuronal Viability by Amyloid Precursor Protein Mutations in Drosophila Shermali Gunawardena, Lawrence S.B. Goldstein

Jun Wu Ph.D student 18th July 2016

Sorting Out Presenilins in Alzheimer’s Disease

How do equivalent cells acquire different cell fates?

WES identification of heterozygous compound mutations in ALPI

Yee-Ming Chan, Yuh Nung Jan Neuron

Christel Brou, Alain Israël

WES identification of heterozygous compound mutations in ALPI

What is the major conclusion of this paper?

Schematic representation of the domain structures of insect enzymes involved in chitin metabolism. Schematic representation of the domain structures of.

General structure of RIFINs and STEVORs

Numb Antagonizes Notch Signaling to Specify Sibling Neuron Cell Fates

The C2H2 zinc-finger factor ztf-16 is required for ver-1 expression.

A Primer on Concepts and Applications of Proteomics in Neuroscience

Mutagenesis of the tRNAse Z Gene in Drosophila

Hernán López-Schier, Daniel St Johnston Developmental Cell

Volume 7, Issue 12, Pages (December 2014)

Notch and the Immune System

Presentation transcript:

Abigail Mabe Cell Biology

* All are indicated as diapause-down regulated (all negative values)

Non-Diapause Genes

CG7012 : Nicastrin (nct) Nicastrin is one of the two major components of the gamma- secretase complex, the other being presenilin, which executes the breakdown of type I integral membrane proteins such as the amyloid precursor protein (APP) and Notch. Nicastrin is produces in fibroblasts and neurons as an endoglycosidase-H-sensitive glycosylated precursor protein (immature nicastrin) and is then changed by glycosylation in the Golgi apparatus and by sialylation in the trans-Golgi network (mature nicastrin)

Subcellular Location plasma membrane Classification Zn-dependent exopeptidase Structure There are 17 alleles that code for nct The nicastrin locus is composed of seven exons (3.4 kb) conserved signal peptide and a C-terminal transmembrane domain.

The nct gene product is required for Psn-mediated transmembrane cleavage Loss of nct activity blocks the build-up of Psn gene product associated with the apical plasma membrane, stops Psn-dependent cleavage of the transmembrane domain of N and stops N signal transduction Transmembrane cleavage of Notch is essential for signal transduction, and transmembrane cleavage of beta-APP creates harmful amyloid peptides connected with Alzheimer's disease

Developmental Biology The transmembrane glycoprotein Nicastrin was identified in a complex with the multipass membrane protein Presenilin. Drosophila nicastrin mutations have been isolated by systematic lethal mutagenesis screening. nicastrin mutants exhibit defective cell fate characterizations at all stages of development, similar to what has been observed in Notch and Presenilin mutants. Loss-of-function mutations have been isolated which affect the larval stage and are larval recessive lethal

Mapped Location of Nicastrin

Amino Acid Sequence MEMRLNAASIWLLILSYGATIAQGERTRDKMYEPIGGASCFRRLNGTHQTGCSSY SGSVGVLHLINVEADLEFLLSSPPSPPYAPMIPPHLFTRNNLMRLKEAGPKNISV LLINRTNQMKQFSHELNCPNQYSGLNSTSETCDASNPAKNWNPWGTGLLHE DFFPIYYIADLDQVTKLEKCFQDFNNHNYETHALRSLCAVEVKSFMSAAVNTEV CMRRTNFINNLGGSKYCDPLEGRNVYATLYPRKPAIENNLETVHTNEKFILVTC RLDTTTMFDGVGLGAMDSLMGFAVFTHVAYLLKQLLPPQSKDLHNVLFVTFNG ESYDYIGSQRFVYDMEKLQFPTESTGTPPIAFDNIDFMLDIGTLDDISNIKLHAL NGTTLAQQILERLNNYAKSPRYGFNLNIQSEMSAHLPPTSAQSFLRRDPNFNA LILNARPTNKYYHSIYDDADNVDFTYANTSKDFTQLTEVNDFKSLNPDSLQMK VRNVSSIVAMALYQTITGKEYTGTKVANPLMADEFLYCFLQSADCPLFKAASYP GSQLTNLPPMRYISVLGGSQESSGYTYRLLGYLLSQLQPDIHRDNCTDLPLHYF AGFNNIGECRLTTQNYSHALSPAFLIDGYDWSSGMYSTWTESTWSQFSARIFL RPSNVHQVTTLSVGIVVLIISFCLVYIISSRSEVLFEDLPASNAALFG

Sequence Comparison..\Clustal Alignment.doc