Wellcome Trust Research Career Development Fellowship: A personal perspective Samantha Sampson Department of Microbiology Centre for Molecular Microbiology.

Slides:



Advertisements
Similar presentations
Liz Shaw Ariel Retik MEDICAL HUMANITIES and PUBLIC ENGAGEMENT AT THE WELLCOME TRUST: FUNDING OPPORTUNITIES.
Advertisements

Veterinary Basic Sciences
Imperial College London July 2010 The Wellcome Trust.
MRC Funded Research Opportunities
Genomic Medicine Wellcome Trust Centre for Human Genetics Jonathan Flint, Peter Donnelly, Richard Mott, Gil McVean.
The Daphne Jackson Trust Dr Katie Perry Chief Executive, Science Writer, Science Communicator, Nuclear Physicist, or busy mum to an adorable but strong.
Overview of Mentored K Awards Shawna V. Hudson, PhD Assistant Professor of Family Medicine and Community Health UMDNJ-RWJMS The Cancer Institute of New.
Prof. Angelo Presenza, PhD 3 rd cycle of the Bologna process ITALY “Modernizing the 3rd cycle at the University of Prishtina and Developing a PhD Program.
Undergraduate and MSc courses in the Division of Biosciences Dr. Christian Rudolph
Getting Started in Research Kathryn Adcock Wellcome Trust University of Birmingham 27 September 2011.
Wellcome Trust Neuroscience Funding
Biomedical Science Funding at the Wellcome Trust Dr Kathryn Adcock Senior Portfolio Developer Neuroscience and Mental Health / Clinical Activities.
Wellcome Trust - Funding the best science
Applying for post-graduate studies Questions to ask yourself: Why am I thinking of applying for post-graduate study? What do I want to achieve? If you.
Securing Wellcome Trust Funding as an Established Researcher
Grant Writing1 Grant Writing Lecture What are the major types of grants available in mental health research? What is the process of grant preparation and.
1 NIH Grant-Writing Workshop Leora Lawton, Ph.D. Executive Director, Berkeley Population Center Summer 2015 Dlab Workshop Session 5: Human Subjects and.
How to Win Funding in Medical Research Cecilia Lindgren Wellcome Trust Research Career Development Fellow.
POST-DOCTORAL RESEARCH FUNDING Lynne Parsons ext Research Support Office.
Professor Tumani Corrah CBE, PhD, FRCP, PWACP. Director, Africa Research Development, Medical Research Council UK & Emeritus Director, MRC Unit, The Gambia.
Clinical Academic Trainees’ Conference 3 November 2012 Clinical Lecturers and Post-doctorates Dolores Conroy PhD Director of Research Fight for Sight.
PROJECT DATECLIENT October 16, 2014 ALABAMA SCIENCE TEACHERS STEM-IQ GEARSEF Orientation.
Alina Schilling EPSRC Career Acceleration Fellow School of Maths & Physics
Early career research: possibilities & opportunities for success Chris Phillipson Keele University.
Wellcome Trust - Funding the best science Dr Helen Fisher Science Programme Manager Molecules, Genes and Cells Fellowship for Researcher Day: Sheffield.
Wellcome Trust - Funding the best science
MRC Special Training Fellowship in Health Service Research: Personal Experience Lynne Ferrar Academic Unit of Bone Metabolism School.
Mentoring Professor Elizabeth Simpson OBE FRS FMedSci Emeritus Professor of Transplantation Biology, Imperial College London Colby Benari Programme Officer,
Research in Genetics Dr. Helena Seth-Smith G and L Wellcome Trust Sanger Institute Cambridge.
The Wellcome Trust Funding opportunities 5 December 2007 Tracy Halpin and Savita Ayyar.
Dr Emma Hudson Grants Adviser Molecular & Physiological Sciences University of Bath – Funders Day 20 th May Funding opportunities.
Funding and Fellowships Dr. Ian Prior School of Biomedical Sciences
Dr. Anne Maria Mullen Ph.D Principal Research Officer Teagasc, Food Chemistry and Technology Department.
Research Program Overview National Institute on Disability and Rehabilitation Research Robert J. Jaeger, Ph.D. Interagency and International Affairs Interagency.
Exploring Bioinformatics Careers. Place of Employment: Seattle Biomedical Research Institute Type of Work: Manages the DNA Sequencing “Core.” The Core.
Academic Pathway Pharmaceutical Sciences NTUSPAA-NA Annual Event San Francisco, CA, August 6, 2005 Diana Shu-Lian Chow, Ph.D. Associate Professor of Pharmaceutics.
Fellowship experiences Ewald Hettema Department of Molecular Biology and Biotechnology.
Fellowships Day at Imperial College Sarah Fox 3 rd July 2007.
Support for probationary staff Chris Pearce School of Engineering, Convenor of Research LTC Away Day.
Postdoctoral Fellowship Opportunities in Engineering 11 June 2012 Jane Williams Research Strategy Manager Faculty of Engineering.
The Royal Academy of Engineering is Britain’s national Academy of Engineering dedicated to the promotion of excellence in the science, art and practice.
Science Foundation Ireland Early Career Researcher Forum, September 2015 Dr Eimear Holohan.
© Imperial College London Wellcome postdoctoral fellowship: application process and experiences as a fellowship holder Rebecca Baggaley Sir Henry Wellcome.
9 th Annual NIHR Trainee Meeting 24 November 2015 Julia Dickinson MRC Programme Manager.
Post-PhD Career Trajectory & Funding Ian Humphreys Wellcome Trust Senior Research Fellow Institute of Infection and Immunity
OMICS international Contact us at: OMICS International through its Open Access Initiative is committed to make genuine and.
Dr Kirsty Newman Evidence-Informed Policy Making.
Promotions on the Physician Scientist/Basic Science Investigator Track Larry L. Swift, Ph.D. Vice Chair for Faculty Affairs Department of Pathology, Microbiology.
Dr Martyn A. McLachlan Department of Materials Imperial College London
NIHR Trainees Coordinating Centre NIHR Research Training Opportunities Isabelle de Wouters NIHR Trainees Coordinating Centre.
Foundation Doctors’ Academic Meeting Kathryn Adcock Wellcome Trust March 2011.
Careers in medical research Anne-Marie Coriat PhD Director Capacity, Skills and Infrastructure Medical Research Council & Chair - RCUK Research Group Dental.
Achieving a Research Fellowship Breast Cancer Campaign Scientific Fellowship.
What are sponsors looking for in research fellows? Melissa Bateson Professor of Ethology, Institute of Neuroscience Junior Fellowships.
I am in the Biotechnology industry
The life of a clinical academic…
Wellcome Trust Neuroscience Funding
NIHR Research Training Opportunities
Performing top research at the Academia
Applying for Fellowships Henry Wellcome experience Ben Wilson benjamin
What are sponsors looking for in research fellows?
Clinical academic careers
Commonwealth Scholarships and Fellowships in the UK
Update on Spanish Recruitment: Students, Staff, Fellows, Associates
Industrial Careers Expo - October 2012, University of Sheffield
Title The NIHR Southampton Clinical Research Facility was established by the Wellcome Trust and the Department of Health in The NIHR Southampton.
Intermediate Fellowships
Wellcome - Funding Opportunities for Clinical Academics
Thomas Mitchell, MA, MPH Department of Epidemiology & Biostatistics
After your PhD – developing independence as a research scientist
Presentation transcript:

Wellcome Trust Research Career Development Fellowship: A personal perspective Samantha Sampson Department of Microbiology Centre for Molecular Microbiology and Infection

Career History Cape Town, South Africa: BSc (Biochemistry & Chemistry) BSc Hons, MSc & PhD (Medical Biochemistry) Mycobacterium tuberculosis strain diversity

Career History Boston, USA: Post-doc Novel TB vaccine efficacy studies

Career History London, UK: Research Fellow Host-pathogen interactions: PE/PPE proteins

WT RCDF Opportunity for postdoctoral scientists to become independent research scientists and to undertake research of high quality Eligibility: 3-6 years research experience from date of PhD degree intellectual contributions to published research demonstrate potential to carry out independent research

WT RCDF Application Procedure: Preliminary application form (25/9/08) Full application (to appropriate funding committee) Panel Interview

My research Worldwide TB incidence

TB: Disease Burden 1/3 rd of world’s population infected with Mycobacterium tuberculosis 8 million incident cases 2 million deaths annually

PE/PPE proteins PPE-MPTR subgroup (up to ~3720 aa) (GG A / N GG A / N ) n PE-PGRS subgroup (up to >1500 aa) PE NXGXGNXG PPE PPE-SVP subgroup (up to ~470 aa) GXXSVPXXWPPE PE “PE-only” subgroup (~110 aa) Subgroup with unique C-terminal region (up to ~560 aa) Subgroup with unique C-terminal region (up to ~600 aa) PE PPE

The proposal Title: The PE and PPE proteins of Mycobacterium tuberculosis and Mycobacterium bovis: exploring their potential as variable antigens Hypothesis: PE and PPE genes of M. tuberculosis and M. bovis encode variable antigens

The proposal Aims: (i) Establish whether the PE and PPE genes are differentially expressed under different in vitro growth conditions and during host infection. (ii) Determine whether PE and PPE epitopes are differentially recognised by the host immune system over the course of an infection. (iii) Elucidate mechanisms of PE and PPE gene regulation.

Kinetics of PE/PPE immune responses >PE35 MEKMSHDPIAADIGTQVSDNALHGVTAGSTALTSVTGLVPAGADEVSAQAATAFTSEGIQLLASNASA... MEKMSHDPIAADIGTQVSDN IAADIGTQVSDNALHGVTAG VSDNALHGVTAGSTALTSVT VTAGSTALTSVTGLVPAGAD TSVTGLVPAGADEVSAQAAT AGADEVSAQAATAFTSEGIQ QAATAFTSEGIQLLASNASA ºC, 5% CO 2, 48 hours Store -80 ºC until use

PE/PPE regulation Labeled probe (0.8 ng Rv1195 upstream region) Unlabeled probe Protein (100 ng, rRv0485-His 6 ) DNA-protein complex Unbound, labelled DNA

Why was my application successful? WT Remit: “… research across all biomedical science … to produce knowledge that can be used to protect and improve human and animal health.” Preliminary data Sponsor Institution Track record Preparation Right place at the right time!

Independent funding: Pros Independence Limited teaching obligations (if you choose) Technical assistance Opportunity to develop own research interests Develop management skills (time, budget, personnel)

Independent funding: Cons Independence Finding a balance Measurable outputs required

Advice Be flexible (personally and professionally) Be pro-active Have a Plan B Research your options D O WHAT YOU ENJOY !!

Acknowledgments Prof. Rob Warren (PhD Supervisor) Prof. Barry Bloom (Post-doc PI) Prof. Douglas Young (RCDF Sponsor) Rachael Goldstone (RA)