Commercial Gluten Test Kits / Methods

Slides:



Advertisements
Similar presentations
Research Techniques Made Simple: Enzyme Immunoassay and ELISA
Advertisements

Antibodies Analytical Techniques Utilizing Antibodies: flow cytometry
1 Gluten-Free Food Labeling Public Meeting August 19, 2005 Rhonda R. Kane, M.S., R.D. Consumer Safety Officer Food Labeling & Standards Staff Office of.
Unit 6 Diagnosis & Follow-up of HIV Infection
Analytical Methods for Allergens
Manaaki Tangata Taiao Hoki protecting people and their environment through science Specialist Science Solutions FOOD ALLERGEN TESTING Peter Cressey ESR.
Evaluation of the IMMY CrAg Lateral Flow Assay for Detection of Cryptococcal Antigen Susan Clarke and Robert Gibb Pathology Queensland – Central, Royal.
Enzyme-Linked Immunoassay Tests for Gluten Content in Food
PESTICIDE RESIDUES MONITORING IN FOODS >>> OUTLOOK >>> MOHAMED H. EL-SAEID, Ph.D. Chemistry & Pesticide Residue Analysis Chemistry & Pesticide Residue.
Detection of Cereal Proteins and DNA Using MS, ELISA, and PCR William J. Hurkman, Ph. D. USDA/ARS Western Regional Research Center Albany, CA.
Validation of Microbiological Methods for Use in the Food Industry Brazilian Association for Food Protection 6 th International Symposium Sao Paulo, Brazil.
Ultra-Sensitive Methods for Pathogen and Cancer Cell Detection Andrew D. Ellington, Ph.D. Department of Chemistry and Biochemistry.
Introduction to ELISA ELISA – short for enzyme- linked immunospecific assay A technique that measures the amount of a specific protein in a solution.
THE DETECTION OF RICIN IN FOOD MATRICES USING ELISA TECHNOLOGY Eric A.E. Garber and Michael A. McLaughlin Division of Natural Products, Center for Food.
Enzyme-linked Immunosorbent Assay
ELISA BASICS Enzyme Linked Immunosorbent Assay Food Safety Scientist Curriculum © 2014 Board of Regents, South Dakota State University iGrow.org This project.
Complement based techniques Complex protein system by which certain antibodies are capable of killing cells Proteins of the complex system are thermolabile.
TESTING AND REGULATION (free from foods) Dr Mike Bromley Genon Laboratories Specialists in immunological and genetic testing for safety and authenticity.
Everything but the gluten-free kitchen sink: Addressing your concerns about labeling, confusing ingredients, and the gluten content of food Part Two Tricia.
© Food Labeling Concerns for CD/DH Mary Schluckebier, MA, Executive Director, CSA Toll Free 877-CSA-4-CSA
1 Meeting Children’s Special Food and Nutrition Needs in Child Nutrition Programs Lesson 5: Managing Celiac Disease.
Celiac Diet By: Alisha Gross, Caitlin Fortenberry, Susie Mays.
(Enzyme Linked Immunosorbent Assay)
International Perspective on Gluten-Free July 14, 2005 Rhonda R. Kane, M.S., R.D. Center for Food Safety and Applied Nutrition U.S. Food and Drug Administration.
Lec 16 Medical biotechnology Shah Rukh Abbas, PhD
Simoa Accelerator Laboratory
FDA Gluten-Free Labeling Public Meeting Compiled by: Jill A. Kuzo, Food Scientist Presenter: Lee Tobin, Team Leader August 19, 2005.
Principles of ELISA. Immunoassay Immunochemical reactions form the basis of a diverse range of sensitive and specific clinical assays. In a typical immunochemical.
Enzyme-Linked Immunosorbent Assay
Gluten contaminations in common foods Service to MEDICEL By Rosy Negri, Alex & Luigi Greco.
Western Blotting.
How Does ELISA Work? By: Ian Lin, Marko Cavar, Justin Chiu & Lily Hou Sep 15, PHM142 Fall.
Enzyme-Linked Immunosorbent Assay [ELISA] BCH 462[practical] Lab#5.
ELISA Assay. What Is It? Enzyme immunoassay (EIA) is a test used to detect and quantify specific antigen-eliciting molecules involved in biological processes,
Immunologic Laboratory Tests Kristine Krafts, M.D.
HIV diagnosis (general) ImmunoassaysNAT (PCR)
All Rights Reserved AEIC 2004.
Development of Prostatic Exosomal Protein Lateral Flow Chromatographic Strips for Detection of Chronic Prostatitis Jiao Zhang MD, PhD. The Brody School.
WHAT IS GLUTEN?. Quick Bread Notes Gluten - a substance present in cereal grains, esp. wheat, that is responsible for the elastic texture of dough; it.
AppliChem © /34 There is another top address in Darmstadt! Immunoassay buffer Principle of Immunoassays patentdocs.typepad.com/.../implications_of.html.
Performance of Chiron Quantitative and Qualitative HBV PCR Assay and Confirmation of HBV Yield Cases Yiu-Lian Fong, Ph.D, Associate Director June 13, 2007.
All Rights Reserved AEIC 2004.
Donald D. Kasarda, Ph.D. Research Chemist (Retired)/Collaborator U.S. Department of Agriculture Agricultural Research Service Western Regional Research.
Simple and complex proteins,. multiprotein complex A multiprotein complex (or protein complex) is a group of two or more associated polypeptide chains.
Immunology. Purpose of the immune system: –Discriminate self from non-self Non-self –Antigens Immunity: –All mechanisms used by the host to protect itself.
Enzyme Linked Immuno Sorbent Assay (ELISA) Enzyme-linked immunosorbent assay (ELISA), also known as an enzyme immunoassay (EIA), is a biochemical technique.
More efficient paper device using PNIPAM 김영완 장욱일 장수영 이원진.
 YEOH HUI SHIH –INTRODUCTION TO HIV  RAJAMANI- ELISA  TIEN WEI PING – WESTERN BLOTTING  YEO HUI YUN –OVERVIEW & CONCLUSION.
The Grain Game © Grain Chain Flour foods Activity session 4 Name the grain! While there are different types of grains, this game focuses on wheat,
Joe Baumert, Ph.D. Food Allergy Research & Resource Program
Enzyme Linked Immunosorbent Assay
Figure S1 A MVNFVSAGLFRCLPVSCPEDLLVEELVDGLLSLEEELKDKEEEEAVLDGL LSLEEESRGRLRRGPPGEKAPPRGETHRDRQRRAEEKRKRKKEREKE EEKQTAEYLKRKEEEKARRRRRAEKKAADVARRKQEEQERRERKWRQ.
Bin essa Amer DT204 Presentation on antireticulin antibody.
Species identification
INTERNATIONAL WINE TECHNICAL FORUM, 2015 ALLERGEN METHOD VALIDATION Steve Tallman 6 th May, 2015.
GRAD (generic Rapid Assay Device) New Product Introduction Dina Gonçalves December 2015.
Target Analyses in Parallel Reaction Monitoring Mode (PRM)
Food Safety and Regulatory Measures 2016 Pauline Titchener Business Development Executive Analytics is the key to safe food – Challenges and the way forward.
Immunoassays are tests that take advantage of the specificity of antibodies to their protein epitotes. Qualitative example: pregnancy test kits, HIV.
Armen Mirzoian, TTB International Wine Technical Forum May 6, 2015
Immunochromatography
Introduction to ELISA ELISA – short for enzyme-linked immunospecific assay A technique that measures the amount of a specific protein in a solution.
Enzyme-Linked Immunosorbent Assay [ELISA]
Immunochromatography
The Importance and Analysis of Aflatoxin and Gluten in Corn
gRAD (generic Rapid Assay Device)
Introduction to ELISA ELISA – short for enzyme-linked immunospecific assay A technique that measures the amount of a specific protein in a solution.
Anaphylaxis to wheat isolates: Immunochemical study of a case proved by means of double-blind, placebo-controlled food challenge  Virginie Leduc, PhD,
Fibronectin-induced integrin-mediated PDGFR-β tyrosine phosphorylation
A24 induces apoptosis of MCL cells.
Presentation transcript:

Commercial Gluten Test Kits / Methods Jupiter Yeung, PhD Principal Scientist Food Products Association FDA Gluten Free Meeting, Aug 19, 2005

Gliadin Detection Methods Immunochemical ELISA Lateral Flow Device Immunoblotting PCR MS MALDI-TOF LC/MS/MS

Sandwich ELISA Signal Detector Antibody Capture Antibody 22 22

Gliadin Antibodies Specificity Skerritt mAb – -gliadin (-gliadin) – wheat – 100% rye – 120% barley – 5% Mendez R5 mAb – QXPFP toxic epitopes of ,,, -gliadins – Equally to wheat, rye and barley Both Ab recognize raw and cooked prolamins

Commercial Gliadin ELISA Kits Company Product LOD* LOQ* Range* Replicates Costs Neogen Alert (Qualitative) 10 1 $237/20Sampl Veratox 5 5-50 $465/38Sampl R-Biopharm RidaScreen 1.5 2.5 2.5-40 2 $425/96 wells RidaScreen Fast 5-40 $400/48 wells Tepnel Gluten Assay Kit, AOAC or High sensitivity 50 50-1000 0.5 5-100 Hallmark HAVen Gluten, AOAC or High sensitivity Diffchamb Transia Plate Gluten $500/96 wells Transia Plate Prolamins 0.8 0.8-12.5 Morinaga Wheat Protein 0.3* 3.12 3.12-20 $600/96 wells * ppm gliadin ppm gluten = ppm gliadin x 2 Converted to ppm from g/mL

Commercial Gliadin ELISA Kits Company Product Validation Neogen Alert Veratox R-Biopharm RidaScreen RidaScreen Fast PWG ring trial Tepnel BioKit Gluten (AOAC OM) High Sensitivity Hallmark HAVen Gluten Diffchamb Transia Plate Gluten NFA, Sweden Transia Plate Prolamins Morinaga Wheat Protein NIHS, Japan

Gliadin ELISA 0 5 10 20 50 ppm gliadin controls

Lateral Flow Device (Dipstick) Positive can mean less than LOD Company Product LOD (ppm gluten) Costs R-Biopharm Rida Quick 10 $200 / 20 strips Tepnel Gluten Rapid 100 $150 / 10 strips Gluten Home $ 75 / 5 strips Positive can mean less than LOD

Lateral Flow Device

Lateral Flow Device                                                                            

Lateral Flow Device

Issues with Gluten Test Kits Ab has different specificities to different prolamins, e.g. Skerritt Ab Various results from different extraction media: 40-60% EtOH, cocktails Different standards used from different kits False positives and negatives require a confirmatory test Limited availability of confirmatory test to most food lab No sampling plan

Extraction Media Aq. Alcohol (40-60% EtOH) Cocktail (reducing agent + others) - interaction of Ab and Ag

Matrix Effect Cocktail (reducing agent + others) - interference with complex food matrices, e.g. milk - interaction of Ab and Ag Samples with high polyphenols, tannins and syrups require fish gelatin to improve recovery

Effects of Extraction Media Hasselberg et al. Proceeding of the 18th Meeting, WPGAT, 2004

Effect of Partial Hydrolysis Ferre et al. Proceeding of the 18th Meeting, WPGAT, 2004

Reference Materials IRMM-480 Wheat Gliadin NIST SRM 1567a Wheat Flour RM 8418 Wheat Gluten RM 8436, 8437, 8438, 8441a Others

Confirmation Methods Ab-Western blot PCR – qualitative, quantitative MS – MALDI-TOF, LC/MS/MS

Garcia et al., Proceeding of the 18th Meeting, WPGAT, 2004

Detection & Speciation Wheat Gliadins Rye Scalins Barley Hordeins Oat Avenins Ab-based + - PCR MS