Domain-SLiM mining from High Throughput Protein Interaction Data Hugo Willy August 19, 2010.

Slides:



Advertisements
Similar presentations
Microarray statistical validation and functional annotation
Advertisements

Protein – Protein Interactions Lisa Chargualaf Simon Kanaan Keefe Roedersheimer Others: Dr. Izaguirre, Dr. Chen, Dr. Wuchty, ChengBang Huang.
MitoInteractome : Mitochondrial Protein Interactome Database Rohit Reja Korean Bioinformation Center, Daejeon, Korea.
Mining proteomes for short motifs (possible potential as bioactive peptides) Proteomes – Man – pathogens – food organisms Computation – Evolutionary conservation.
Regulatory Motifs. Contents Biology of regulatory motifs Experimental discovery Computational discovery PSSM MEME.
Protein Structure Database Introduction Database of Comparative Protein Structure Models ModBase 生資所 g 詹濠先.
Hidden Markov models for detecting remote protein homologies Kevin Karplus, Christian Barrett, Richard Hughey Georgia Hadjicharalambous.
©CMBI 2005 Exploring Protein Sequences - Part 2 Part 1: Patterns and Motifs Profiles Hydropathy Plots Transmembrane helices Antigenic Prediction Signal.
Structural bioinformatics
Cluster analysis of networks generated through homology: automatic identification of important protein communities involved in cancer metastasis Jonsson.
Genome-wide prediction and characterization of interactions between transcription factors in S. cerevisiae Speaker: Chunhui Cai.
Protein Modules An Introduction to Bioinformatics.
Sequence comparisons June 23, 2009 Learning objectives-Understand the concept of sliding window programs. Understand difference between identity, similarity.
Computational Biology, Part 2 Sequence Comparison with Dot Matrices Robert F. Murphy Copyright  1996, All rights reserved.
Lecture 12 Splicing and gene prediction in eukaryotes
Detecting the Domain Structure of Proteins from Sequence Information Niranjan Nagarajan and Golan Yona Department of Computer Science Cornell University.
Systematic Analysis of Interactome: A New Trend in Bioinformatics KOCSEA Technical Symposium 2010 Young-Rae Cho, Ph.D. Assistant Professor Department of.
Protein Interaction Networks Aalt-Jan van Dijk Applied Bioinformatics, PRI, Wageningen UR & Mathematical and Statistical Methods, Biometris, Wageningen.
Alignment Statistics and Substitution Matrices BMI/CS 576 Colin Dewey Fall 2010.
Multiple Sequence Alignment CSC391/691 Bioinformatics Spring 2004 Fetrow/Burg/Miller (Slides by J. Burg)
Protein Tertiary Structure Prediction
Protein Bioinformatics Course
Protein domains. Protein domains are structural units (average 160 aa) that share: Function Folding Evolution Proteins normally are multidomain (average.
Structural Bioinformatics R. Sowdhamini National Centre for Biological Sciences Tata Institute of Fundamental Research Bangalore, INDIA.
Guiding Motif Discovery by Iterative Pattern Refinement Zhiping Wang, Mehmet Dalkilic, Sun Kim School of Informatics, Indiana University.
1 PyMOL Evolutionary Trace Viewer 1.1 Lichtarge Lab Sept. 13, 2010.
PART II. Prediction of functional regions within disordered proteins Zsuzsanna Dosztányi MTA-ELTE Momentum Bioinformatics Group Department of Biochemistry.
© Wiley Publishing All Rights Reserved. Building Multiple- Sequence Alignments.
The Chemistry of Protein Catalysis
Clustering of protein networks: Graph theory and terminology Scale-free architecture Modularity Robustness Reading: Barabasi and Oltvai 2004, Milo et al.
Computational prediction of protein-protein interactions Rong Liu
Statistical Analysis for Word counting in Drosophila Core Promoters Yogita Mantri April Bioinformatics Capstone presentation.
Discovering the Correlation Between Evolutionary Genomics and Protein-Protein Interaction Rezaul Kabir and Brett Thompson
CS5263 Bioinformatics Lecture 20 Practical issues in motif finding Final project.
A Study of Residue Correlation within Protein Sequences and its Application to Sequence Classification Christopher Hemmerich Advisor: Dr. Sun Kim.
Chapter 3 Computational Molecular Biology Michael Smith
Protein Classification II CISC889: Bioinformatics Gang Situ 04/11/2002 Parts of this lecture borrowed from lecture given by Dr. Altman.
Exploring Alternative Splicing Features using Support Vector Machines Feature for Alternative Splicing Alternative splicing is a mechanism for generating.
Biological Signal Detection for Protein Function Prediction Investigators: Yang Dai Prime Grant Support: NSF Problem Statement and Motivation Technical.
BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha.
Starting Monday M Oct 29 –Back to BLAST and Orthology (readings posted) will focus on the BLAST algorithm, different types and applications of BLAST; in.
Finding Patterns Gopalan Vivek Lee Teck Kwong Bernett.
Data Mining the Yeast Genome Expression and Sequence Data Alvis Brazma European Bioinformatics Institute.
Protein Structure Prediction: Homology Modeling & Threading/Fold Recognition D. Mohanty NII, New Delhi.
Reverse Interactomics
Statistical Testing with Genes Saurabh Sinha CS 466.
Genome annotation and search for homologs. Genome of the week Discuss the diversity and features of selected microbial genomes. Link to the paper describing.
Russell Group, Protein Evolution _________ ____ Rob Russell Cell Networks University of Heidelberg Interactions and Modules: the how and why of molecular.
Feature Extraction Artificial Intelligence Research Laboratory Bioinformatics and Computational Biology Program Computational Intelligence, Learning, and.
. Finding Motifs in Promoter Regions Libi Hertzberg Or Zuk.
Sequence Alignment.
Doug Raiford Phage class: introduction to sequence databases.
Discovering functional interaction patterns in Protein-Protein Interactions Networks   Authors: Mehmet E Turnalp Tolga Can Presented By: Sandeep Kumar.
Query sequence MTYKLILNGKTKGETTTEAVDAATAEKVFQYANDN GVDGEWTYTE Structure-Sequence alignment “Structure is better preserved than sequence” Me! Non-redundant.
The statistics of pairwise alignment BMI/CS 576 Colin Dewey Fall 2015.
Final Report (30% final score) Bin Liu, PhD, Associate Professor.
Title: Assign Pathways to Gene Set June 21, 2007 Guanming Wu.
Artificial Intelligence Research Laboratory Bioinformatics and Computational Biology Program Computational Intelligence, Learning, and Discovery Program.
Network Motifs See some examples of motifs and their functionality Discuss a study that showed how a miRNA also can be integrated into motifs Today’s plan.
Protein families, domains and motifs in functional prediction May 31, 2016.
Tzachi Hagai, Ariel Azia, M. Madan Babu, Raul Andino  Cell Reports 
Statistical Testing with Genes
Matt Menke, Tufts Bonnie Berger, MIT Lenore Cowen, Tufts
Identification of protein-protein binding motifs
Finding regulatory modules
SEG5010 Presentation Zhou Lanjun.
Applying principles of computer science in a biological context
Nora Pierstorff Dept. of Genetics University of Cologne
Tzachi Hagai, Ariel Azia, M. Madan Babu, Raul Andino  Cell Reports 
Statistical Testing with Genes
Presentation transcript:

Domain-SLiM mining from High Throughput Protein Interaction Data Hugo Willy August 19, 2010

Introduction to SLiM It stands for (Protein) Short Linear Motif By its name, it is a short linear stretch of region in a protein sequence that is recognized by another protein for binding It averages at 8-12 amino acids where some can go as short as three amino acids. It is currently one of the special mechanism of a protein recognizing its interaction partner

Protein Interaction in general Some proteins only function in terms of a complex. They have to be in a certain combination. These are called the obligate complexes. Their binding surface are usually large to provide strong chemical interactions.

Protein Interaction in general (2) On the other hand, some complexes are formed only “on-demand”. Once the task is done, they dissociate. These are called the transient complexes. The interaction surface of this type of interaction is generally smaller. SLiM based interaction is one of the transient ones.

Picture of non-linear interface (common case in obligate complexes) The interaction region is non linear

Picture of Linear interface The protein chain bound is linear on the interface of the partner.

Protein domains recognizing SLiMs In reality, the task of recognizing a SLiM often is performed by specialized protein domain. Some of the most well known example is the SH3 domain which recognize P..P motif where P is a proline amino acid. WW domains recognize PP.Y motif. These SLiMs, along with their functions (or domain association) are listed in databases like Eukaryotic Linear Motif (ELM) [1] and MiniMotif (MnM) [2]

Methods of finding SLiMs in proteins The SLiMs listed in the two databases are mostly results of experimental procedures like mutagenesis and phage display. They are laborious and expensive.

Computational Method to detect SLiMs From Sequence-based data (the focus of this talk) From Structural data – earlier this year, we published SLiMDiet [3], which is currently the most comprehensive SLiM listing from the PDB.

Sequence-based SLiM detection Protein sequence based – Given a set of grouped sequence, find motif that occurs in unrelated sequences. – Example: DILIMOT [4], SliMDisc [5], SLiMFinder [6] Protein interaction based – Find correlated motifs that is over-represented in interacting proteins – Example: D-STAR [7], MotifCluster [8], SLIDER [9]

Protein Sequence Based Methods Rely on occurrences on unrelated sequences. May need to remove protein domains from the motif search space because of their similarity The grouping of the sequences can be manual – by manually selecting known sequences with a certain property. For example, proteins that are exported outside the cells can be grouped to find the motif that is responsible for the export mechanism. Automated grouping – using the protein domain information or GO ontology annotation

Protein Sequence Based Methods (2) Once the grouping is done, the motif is mined using standard motif searching like MEME or TEIRESIAS. Because of the speed and rigid requirement of motif length of MEME, usually TEIRESIAS is the program of choice (it can start with a motif length and try to combine the motifs into longer ones). Teiresias uses L,W motif – motif of length L over window of length W.

Protein Sequence Based Methods (3) The problem of this method is that it relies too much on the initial grouping. The grouping must have the motif really over- represented. All paper in this line have been comparing their performances in the ELM set (a dataset of curated sequences which are known to contain the ELM motif).

Protein Sequence Based Methods (4) They also found some significant motifs from the group of protein known to interact with a certain protein domain which is known to have such SLiM interaction. DILIMOT got published in PLoS Biology as they managed some biological validations.

Interaction based methods To be precise, none of the interaction based methods designed up to date were specifically designed to find SLiMs. Most of them are finding “correlated motif pair”. These are a pair of motif which occur consistently more frequently in interacting proteins as opposed to some background model. Examples: D-STAR, MotifCluster and SLIDER

Interaction based methods (2) These methods rely solely on the density of interactions between the two set of proteins that contain the motif pair respectively. D-STAR and SLIDER uses a Chi-Square scoring while MotifCluster uses hypergeometric scoring. As I shall show later, they may not be suitable in finding SLiMs – they are by design finding interaction motif which may not be the binding motif themselves.

My current attempt - SLIMMER I learnt that most of the time SLiMs are bound by a non-linear interface. Thus, it is not very feasible to hope that both side of the interface contain linear motifs. This was mentioned by one of D-STAR’s reviewer. So, I try to find correlated motifs where one of them is a protein domain – which is by definition non-linear (they are distinct protein folds in 3D)

SLIMMER (2) I basically combine the good ideas from many programs to accomplish this. The strength of correlated motifs is that they can find seemingly insignificant motifs (by virtue of their sequence occurrence) by using the fact that once they occur, they interact intensively with the partner motif. The correlated motif uses over-representation of the interaction occurrence, as opposed to sequence occurrence.

SLIMMER (3) However, the tricks of sequence based method can also be applied. They requires occurrence of the SLiMs in non- homologous sequences (which can be considered as independent occurrences). This non homology is never considered in D- STAR, MotifCluster and SLIDER. We should consider only non-homologous interactions when we count the occurrence of the motif pair.

SLIMMER (4) The SLiM itself must have an occurrence probability better than random. MotifCluster uses the binomial distribution to compute the probability of seeing a motif M, k times in the sequence set (this is threshold approach). I also tried another approach where I combine the binomial p-value of the motif occurrence and the hypergeometric p-value of the interaction occurrence.

SLIMMER (5) Current results, SLIMMER is better than all methods available and it is also fast. I am still implementing a better background model to deal with low complexity regions – using a simple 3 rd or 4 th order markov. I also in the middle of trying a motif model that allows choices like [LIVM], [FWY] or [KRH] The program allowing these currently is only SLiMFinder and it is very slow and inaccurate for now.

References [1] P Puntervoll et al. ELM server: A new resource for investigating short functional sites in modular eukaryotic proteins. Nucleic Acids Res., 31(13):3625–3630, [2] S Rajasekaran et al. Minimotif miner 2nd release: a database and web system for motif search. Nucleic Acids Res., 37(Database issue):D185–190, [3] W Hugo et al. SLiM on Diet: finding short linear motifs on domain interaction interfaces in Protein Data Bank. Bioinformatics (8): [4] V Neduva et al. Systematic discovery of new recognition peptides mediating protein interaction networks. PLoS Biol., 3(12):e405, [5] N E Davey et al. SLiMDisc: short, linear motif discovery, correcting for common evolutionary descent. Nucleic Acids Res., 34(12):3546–3554, [6] R J Edwards et al. SlimFinder: a probabilistic method for identifying overrepresented, convergently evolved, short linear motifs in proteins. PLoS ONE, 2(10):e(967), 2007.

References (2) [7] S H Tan et al. A correlated motif approach for finding short linear motifs from protein interaction networks. BMC Bioinformatics, 7:502, [8] H C Leung et al. Clustering-based approach for predicting motif pairs from protein interaction data. J Bioinform Comput Biol Aug;7(4): [9] P Boyen et al. SLIDER: Mining correlated motifs in protein-protein interaction networks. In Proceedings of the 2009 Ninth IEEE International Conference on Data Mining, pages 716–721, 2009.