Christian Francom, Jeffrey Caldwell, Barbara Trask, Ph.D.

Slides:



Advertisements
Similar presentations
Cell Adhesion and Extracellular Matrix. Cells in tissues can adhere directly to one another (cell–cell adhesion) through specialized integral membrane.
Advertisements

Fig Simplified drawing of a cross-section through part of the wall of the intestine. Each tissue is an organized assembly of cells held together.
Extracellular Structures, Cell Adhesion & Cell Junctions.
L312/Spring 2003Lecture 22Drummond April 7 For today: Start Chapter 21; tissue structure and connections today (skip plant tissues) Last time: Anaphase.
Extra cellular components Collagen microfibrils Image Credit: Fine structure of collagen circa 1948Fine structure of collagen circa 1948.
Concept 6.7: Extracellular components and connections between cells help coordinate cellular activities Most cells synthesize and secrete materials that.
Identification of a Mammalian Homolog to Amphibian Allurin, a Sperm Chemoattractant Zachary Harrison, Deborah D. Ricker, Ph.D., and Jeffrey P. Thompson,
A Novel Multigene Family May Encode Odorant Receptors: A Molecular Basis for Odor Recognition Linda Buck and Richard Axel Published in Cell, Volume 65,
16 and 20 February, 2004 Chapter 9 Genomics Mapping and characterizing whole genomes.
The Central Dogma of Molecular Biology (Things are not really this simple) Genetic information is stored in our DNA (~ 3 billion bp) The DNA of a.
Timing and Location of the Elastic Extracellular Matrix Protein MAGP During Embryonic Development Justin Harper and Barbara Trask Ph.D.
DNA and Chromosome Structure. Chromosomal Structure of the Genetic Material.
Expression Analysis of Activating Transcription Factor 4 (ATF 4) in Zebrafish: Implications for Coffin-Lowry Syndrome Introduction Objectives Methods Results.
Alterations in Expression Levels of Synapsin IIa After Haloperidol Treatment in Zebrafish Embryos (Danio Rerio) Rachel Klein, Department of Biological.
Investigation of Syntaxin 3B in Developing Zebrafish Embryos Derek Anderson* and Wendy Boehmler, PhD Department of Biological Sciences, York College of.
Introduction to biotechnology Haixu Tang School of Informatics.
II: mechanical engineering
Manufacture of Human Interleukin 13 Protein Using a Prokaryotic Expression System Ryan Rupp, York College of Pennsylvania, Department of Biological Sciences.
Genomic walking (1) To start, you need: -the DNA sequence of a small region of the chromosome -An adaptor: a small piece of DNA, nucleotides long.
PV92 PCR/Informatics Kit
Polymerase Chain Reaction PCR. invented by Karry B. Mullis (1983, Nobel Prize 1993) patent sold by Cetus corp. to La Roche for $300 million depends on.
DRAWING LAB HISTOLOGY: CONNECTIVE TISSUE. HW: PAGE 150 Find a Group of 4 to help you complete the Analysis & Review Questions! Each person should do 5.
DNA Technology. Overview DNA technology makes it possible to clone genes for basic research and commercial applications DNA technology is a powerful set.
The Mammalian Protein – Protein Interaction Database and Its Viewing System That Is Linked to the Main FANTOM2 Viewer Genome Research (2003) Speaker: 蔡欣吟.
MCB 7200: Molecular Biology Biotechnology terminology Common hosts and experimental organisms Transcription and translation Prokaryotic gene organization.
File 5 MOUSE sequences used in target gene promoter regions to detect NFATc1 protein binding by ChIP.
Evidence that talin alternative splice variants from Ciona intestinalis have different roles in cell adhesion.
Dr Mahmood S Choudhery, PhD Assistant Professor Advance Center of Research in Biomedical Sciences Incharge Tissue Engineering Laboratory, Mayo Hospital.
Neutrophil-specific Overexpression of FCHO2, a PCH family protein, in Danio rerio Chelsey Warning and Kate Cooper, PhD Loras College Department of Biology.
Trends Biomedical Science
Identification of a Homolog for a Potential Sperm Chemoattractant in the Zebrafish, Danio rerio Aiden Soroko Department of Biological Sciences, York College.
Molecular Cloning.
CONNECTIVE TISSUE. Connective Tissue Most abundant and widely distributed Types –Connective tissue proper –Cartilage –Blood –Bone.
The role of of SynCAM2a in synapse formation Sofia Nakhnikian-Weintraub, Smith College 2012 Mentor: Courtney Easley-Neal, PI: Phil Washbourne.
HIP14 in zebrafish was successfully cloned into a pDrive and sequenced. Alignment analysis was performed by comparing the amino acid sequence in zebrafish.
Topic Cloning and analyzing oxalate degrading enzymes to see if they dissolve kidney stones with Dr. VanWert.
The role of microfibrillar-associated protein 4 (MFAP4) in asthma Bartosz Pilecki PhD student Institute of Molecular Medicine University of Southern Denmark,
Morphogenesis Differentiation – 4 Cell-cell communication Lecture 12 BSE
Relationship Between STAT3 Inhibition and the Presence of p53 on Cyclin D1 Gene Expression in Human Breast Cancer Cell Lines Introduction STAT3 and p53.
Large black circles: query genes grey circles: interacting or related proteins Light grey line: consolidated pathways Yellow: predicted pathways Green:
Prader Willi Syndrome & Necdin
By: Holly Heacock Prader Willi Syndrome & Necdin.
DNA Replication The process to create a second equivalent DNA molecule from one original.
Fibrous proteins ELASTIN.
Microfibrillar-associated protein 4 is a novel regulator of elastic fiber assembly and integrin-dependent cellular signaling Bartosz Pilecki Institute.
Kyla Esposito Fay Lab 4/29/17
Fatima Obeidat. MD Lecture I
Integrin signalling Vytášek 2010.
ANIMAL CELL CULTURE.
Fibrous proteins ELASTIN.
PBIO 4500/5500: Biotechnology and Genetic Engineering
Supplemental Figure 2. (A) AtplaIVA-1 and AtplaIVA-2 null transcription lines for AtPLAIVA mRNA. RNAs from the relevant wild type Col were isolated.
Zebrafish msxe Expression Analysis
Workshop on the analysis of microbial sequence data using ARB
DNA-based technology New and old technologies that are utilized in biotechnology DNA cloning DNA libraries Polymerase chain reaction (PCR) Genome sequencing.
Integrin signalling Vytášek 2009.
Biotechnology and Genetic Engineering PBIO 450/550
Richmond W. Jeremy, Elizabeth Robertson, Yaxin Lu, Brett D. Hambly 
Figure 4 Diverse molecular mechanisms of long non-coding RNAs
Volume 58, Issue 4, Pages (October 2000)
Extra cellular components
Olivier Le Saux, Severa Bunda, Christopher M
The Bare Lymphocyte Syndrome: Molecular Clues to the Transcriptional Regulation of Major Histocompatibility Complex Class II Genes  Angela DeSandro, Uma.
Understanding the mechanism of Chemokine CXCL13 and Glycosaminoglycan interaction will help improve immunotherapies. By Jacob Rodriguez These can be changed.
The abcc6a Gene Expression Is Required for Normal Zebrafish Development  Qiaoli Li, Sara Sadowski, Michael Frank, Chunli Chai, Andras Váradi, Shiu-Ying.
L. De Franceschi, Ph. D. , L. Roseti, Ph. D. , G. Desando, Ph. D. , A
Models for the role of WW-domain proteins in regulation of tombusvirus replication. Models for the role of WW-domain proteins in regulation of tombusvirus.
Cloning and mapping of zebrafish nls/raldh2.
Supplementary Fig. 1 bp E F G H I Hybrid 1 SP2/0 MW P3X (-)
Production of self-assembling biomaterials for tissue engineering
Presentation transcript:

Christian Francom, Jeffrey Caldwell, Barbara Trask, Ph.D.

Extracellular Matrix Functions Structure—tense or elastic Cellular Adhesion Cellular Motility Molecular Reservoir

Elastic Extracellular Matrices Component parts Elastin Microfibrils Fibrillins MAGPs Fibulins Other proteins and proteoglycans Disorders involving the Elastic ECM Elastin SVAS Microfibrils Marfan Syndrome

Question How do the microfibrillar proteins contribute to the function of the elastic extracellular matrix? When and where is each expressed? What inter-molecular interactions are maintained?

Model Organism Zebrafish (Danio rerio) External fertilization and development Colorless during the first few days of development Genome sequenced (although not assembled) **first evolutionary organism to have functional elastic extracellular matrix Easily maintained

Stages of Z-fish Development

Sequences and Primers Fibrillin atggcagcctgtcctgaattaatcttggaaagagagggaggagaaggagtggatgggggattctttaaggcgaagatgactaaggat ttggtggaacgggagattcgcatcacagatgtgcagccggcaaatctgcagcaactgcgtgatgctgtcatctcaaaattggccaaaa tctctgaggaatatttccagtaccttgttgaatctttgccacaaagaattgaggcatttgtgaaagcaaaaaggatgtccaacctggag ggagccccaggctccaggatattctcagctcaggatgtgaacgagtgcaacgaccccaacacctgcatcagcggtctgtgtctgaac acccctggcagctacatctgcagctgcccccccgactttgagctcaatcccactggagtcggctgcgtcgacactcgctctggaaact gctacctggacgtccagtaccgaggcgatttctctgagagtctgagctgctccaatgagattggagtgggagtgtccaaagcgtcctg ctgctgttctaggggtgtggcctggggacagccctgcgaggcctgtccatcactcaactccaagatctgtttcactgcacaacctgaaa tctccagtctggtgcagggagagaccagccagtgcttccccaggaggagtatccagtgctgggacacattagcggctcattcccttgg gcaagcctggagctcagatggccagctgcacgtttccactcttcatctttgttgtggtgtgaaagaggagaaggagggtttaggaaaa caaaaaagcagtggacagagtgatgttacaaagacaacaggcttcacacagagctctgacagtcgcgtcaaagcgagtgcgctgtta ttaaaatggtaccgtcccagtgacagctctcacagctttatttttgcagtgtcaggactacggtccaatcatgcaatagtagaggacatc cgtctgttcaacagtaagcaatatggagctgagccgctgaaagaactgctcaaactactaccagaagcagatgaggtgaagagattg agagaattcaaaggagacgcaaataagctgacactggttgattccttcatgttccagctcattcaagtaccacgctttgatgtgcgtatc gaggtcatggtacttcaagaagagtttttcccattatgtactgccatgagtcgtgacatcaacattgtgcgccaggcaactgaagctgt gcctgtattagccttctctaagaaaccaatggctcatgaccttttagtcctgacaggtggctatgcaggaaacgctgtaggcttcaaatt gtcctctcttctctctctggctgacacaaaggccaacaagcctggcatgaacctgctccattttgtggcattactctcgaggatcttctct gtgttttcacagggtggctatgcaggaaacgctgtaggcttcaaattgtcctctcttctctctctggctgacacaaaggccaacaagcct ggcatgaacctgctccattttgtggcattagaagcacagaaaaaggatgaggcacttttaaagttcccagagaagctaacacatattc agagtgcagccagaatttcagtagaaaatatagaaggagagttttcctcactctatgtgaaaacacggtctttggaacagaagattcaa gatgacgatgagctgcaaaagcagctagatccatttttgcagagctctgcaaaagccttgcaggaccttaagcaccgcaggctggact tgcgcaaagagggtaatgccctcattgacttcttctgtgaagacaaagacaccttcaaattggatgagtgcttcagaatcttccaagatt tctgtctaaagttcaaaaaagctgtgaaggacaactcggacagagaactgaaagaggaagctagacagcgccgcttacgggaacta gaggagagacggtgtgcctggggtgcagccaatattgaaacaggtggtaatggaggttttggtcgcagcagcagtgaaaatgatgtt gacatcttaaccaaagatggcctcctagacttcctgcttcaatcaagacctcaaagcccccacagtcctttaggacgctcagctagtgc tcgccgctaccaccacacatctagtgaccgcagcctccgtggctatatggagctggtctctgggtcttcagcaagtgaatacgccaaa ttcagcagcctgccacgttcaagcaggaaccatcaaagaaagaccatgccatggcttgtcttgcaggatgataatagagagttgattc cacaaagtcaggtttaccaagagaagttagcagtttcacaaagggttgagactgaaccaatcagtcctttggcaagatactcaaattta ggctacaacttgaacagtgatccctatagtaataataataacaattatagttctctttctgaaggtggtcttacacctcgattaaataaaa caaagaatgtctttcaggggacatctggtcaaggcattggacacatgaatgtttctgttgagaaacgcaaactagtgcctgggcttcaa ccctttgagataaccagccagatcaataataacagtcatgtttctttggacaatcaacatgaagtgtgtgtgactgatctggaacgaga agaccttcccaaagcttttgttcttgatacaccaccatctagtagaagttctgaggaggggcataagctagaaaaagtatggaatgaca aaatcatctcatcacagagagacgaagcagacacaagtaccttctcttcaacatcttgtgacaccccattgccccttgatccctccagt aaaaaacctgtgttttatgtcatggactgcactgaaacggattgttccattgtgttggactgttctgagattgagagttctcctattataa aagaaggacctggacttatcccaaagttacaggatgtcaactttccaagaatcattcaagacaccaattctctttcatccaattttgagt cttcagactgtcactttgtgtccacatcaagtgatgaaccatttgtaggaagggtcgatcaaacttcagaatcagtcagtccatctgtaa caactgaagaagcagagacagacagctgtgacacagctgaagggcaaagagttgatgagaaaggtgttcagacaggtagccccaaa acgacacttatcaaaaccaagacttcatccaaagggatgactgctcacaccagccgtcctacaagaaccctcacagctactgagactc agaacatgcgaaaagtagtgcccattacaaggcaaaatcgatctagtagcagcatgagaaaggttgataaaccacctgtacatgaga gctctgaacccagacgtccatttcgagaccaaagcatgccagccagaagaggcgagagacaaggtagacctacaagacattcaagc cttccaccagaggatcctaggacaccaagaggttcgacaccaagcagctctcgttggggaagggactcaattcaacacaggccctcc atcaagaaagccaatgccaaacctgttcgtaacattcctaaaccagcaccagaggaaaagatgtgtcgctctacaatgcgtgccttgg ctcaagctcaggctcaaggaacctcagaaggaggtaccgctgacagccctaacaccaccccaaaaagttcttcacctttgcctagctt tgctcgcaacactgtggcatctacttctagatctaaaaaagacatgccatcagcaactgtaaccggaacaccatcaaagagcctatcg agaactagctctcagagattgcctggtggtagaacagagtctgtcagtagcgggcctttaccaaggagtgaggataaactaggaggct cgattaggagggttcaaagtgtaagagcttccagtcgaagcagtgacacaccttcacaatctggtcgggatcactcccttaaaagtag cagtttctcagacagatccacaccaactagagacaccatcatctccagcaggaccagcaaacccacatggaaatag MAGP atgagactctgttacctgcttctgctgtcactgccgggtctgctggctcaggtgcagaactat gatgaggattatacagacatcttcggtaacagcaacaactacgacaaccccttcttctacca gcagcagatattacagacgcagacgtcagggcctgaacagaacgcgctggatggacagac agagccgactgaacctggaccgctggactgtcgtgaggagcagtatccctgcactcggctc tattctgtccatcagccgtgtaaacagtgtctgaacagcatctgcttctacagtctgcgcagg atgtatgtgatcaataaggaggtgtgtgtgcggacggtgtgtgcacatgaggagctcttgag agcggatctgtgtcgtgaccagttcccccgctgtggtgtaatggcgcacattggccagtgtg gggcgatggggagcaactgcgccaggagttgtggatcctgctaa

Expression Data Fibrillin MAGP GAPDH Control

Future Possibilities More replicates should be done Analysis with Real-Time PCR Alternative primers should be made In situ hybridization should localize expression

Question How do the microfibrillar proteins contribute to the function of the elastic extracellular matrix? When and where is each expressed? What inter-molecular interactions are maintained?

Intermolecular interactions Fibrillin interacts with: MAGP interacts with:  MAGP  CSPG  LTGF-β  Others?  Fibrillins  CSPG  Elastin  Others?

Mammalian Structure of Fibrillin-1

Isolated Bands of LTGF-β Domains bp 200bp 100bp

LTGF-β Binding Domains ….MAACPELILEREGGEGVDGGFFKAKMTKDLVEREIRITDVQPANLQQLRDAVISKLAKISEEYFQYLVE SLPQRIEAFVKAKRMSNLEGAPGSRIFSAQDVNECNDPNTCISGLCLNTPGSYICSCPPDFELNPTGVG C VDTRSGNCYLDVQYRGDFSESLSCSNEIGVGVSKASCCCSRGVAWGQ PCEACPSLNSKICFTAQPEISSLVQGET SQCFPRRSIQCWDTLAAHSLGQAWSSDGQ LHVSTLHLCCGVKEEKEGLGKQKSSGQSDVTKTTGFTQSSDSRVKASALLLKWYRPSDSSHSFIFAVSGL RSNHAIVEDIRLFNSKQYGAEPLKELLKLLPEADEVKRLREFKGDANKLTLVDSFMFQLIQVPRFDVRIEV MVLQEEFFPLCTAMSRDINIVRQATEAVPVLAFSKKPMAHDLLVLTGGYAGNAVGFKLSSLLSLADTKA NKPGMNLLHFVALLSRIFSVFSQGGYAGNAVGFKLSSLLSLADTKANKPGMNLLHFVALEAQKKDEALL KFPEKLTHIQSAARISVENIEGEFSSLYVKTRSLEQKIQDDDELQKQLDPFLQSSAKAL QDLKHRRL DLRKEGNALIDFFCEDKDTFKLDECFRIFQDFCLKFKKAVKDNSDRELKEE ARQR RLRELEERRCAWGAANIETGGNGGFGRSSSENDVDILTKDGLLDFLLQSRPQSPHSPLGRSASA RRYHHTSSDRSLRGYMELVSGSSASEYAKFSSLPRSSRNHQRKTMPWLVLQDDNRELIPQSQVYQEKLA VSQRVETEPISPLARYSNLGYNLNSDPYSNNNNNYSSLSEGGLTPRLNKTKNVFQGTSGQGIGHMNVSV EKRKL VPGLQPFEITSQINNNSHVSLDNQHEVCVTDLEREDLPKAFVLDTPPS SRSSEEGH KLEKVWNDKIISSQRDEADTSTFSSTSCDTPLPLDPSSKKPVFYVMDCTETDCSIVLDCS EIESSPIIKEGPGLIPKLQDVNFPRIIQDTNSLSSNFESSDCHFVSTSSDEPFVGRVDQTSESVSPSVTTEEA ETDSCDTAEGQRVDEKGVQTGSPKTTLIKTKTSSKGMTAHTSRPTRTLTATETQNMRKVVPITRQNRSS SSMRKVDKPPVHESSEPRRPFRDQSMPARRGERQGRPTRHSSLPPEDPRTPRGSTPSSSRWGRDSIQHR PSIKKANAKPVRNIPKPAPEEKMCRSTMRALAQAQAQGTSEGGTADSPNTTPKSSSPLPSFARNTVASTS RSKKDMPSATVTGTPSKSLSRTSSQRLPGGRTESVSSGPLPRSEDKLGGSIRRVQSVRASSRSSDTPSQSG RDHSLKSSSFSDRSTPTRDTIISSRTSKPTWK

LTGF-β Binding Domains ….MAACPELILEREGGEGVDGGFFKAKMTKDLVEREIRITDVQPANLQQLRDAVISKLAKISEEYFQYLVE SLPQRIEAFVKAKRMSNLEGAPGSRIFSAQDVNECNDPNTCISGLCLNTPGSYICSCPPDFELNPTGVG C VDTRSGNCYLDVQYRGDFSESLSCSNEIGVGVSKASCCCSRGVAWGQ PCEACPSLNSKICFTAQPEISSLVQGET SQCFPRRSIQCWDTLAAHSLGQAWSSDGQ LHVSTLHLCCGVKEEKEGLGKQKSSGQSDVTKTTGFTQSSDSRVKASALLLKWYRPSDSSHSFIFAVSGL RSNHAIVEDIRLFNSKQYGAEPLKELLKLLPEADEVKRLREFKGDANKLTLVDSFMFQLIQVPRFDVRIEV MVLQEEFFPLCTAMSRDINIVRQATEAVPVLAFSKKPMAHDLLVLTGGYAGNAVGFKLSSLLSLADTKA NKPGMNLLHFVALLSRIFSVFSQGGYAGNAVGFKLSSLLSLADTKANKPGMNLLHFVALEAQKKDEALL KFPEKLTHIQSAARISVENIEGEFSSLYVKTRSLEQKIQDDDELQKQLDPFLQSSAKAL QDLKHRRL DLRKEGNALIDFFCEDKDTFKLDECFRIFQDFCLKFKKAVKDNSDRELKEE ARQR RLRELEERRCAWGAANIETGGNGGFGRSSSENDVDILTKDGLLDFLLQSRPQSPHSPLGRSASA RRYHHTSSDRSLRGYMELVSGSSASEYAKFSSLPRSSRNHQRKTMPWLVLQDDNRELIPQSQVYQEKLA VSQRVETEPISPLARYSNLGYNLNSDPYSNNNNNYSSLSEGGLTPRLNKTKNVFQGTSGQGIGHMNVSV EKRKL VPGLQPFEITSQINNNSHVSLDNQHEVCVTDLEREDLPKAFVLDTPPS SRSSEEGH KLEKVWNDKIISSQRDEADTSTFSSTSCDTPLPLDPSSKKPVFYVMDCTETDCSIVLDCS EIESSPIIKEGPGLIPKLQDVNFPRIIQDTNSLSSNFESSDCHFVSTSSDEPFVGRVDQTSESVSPSVTTEEA ETDSCDTAEGQRVDEKGVQTGSPKTTLIKTKTSSKGMTAHTSRPTRTLTATETQNMRKVVPITRQNRSS SSMRKVDKPPVHESSEPRRPFRDQSMPARRGERQGRPTRHSSLPPEDPRTPRGSTPSSSRWGRDSIQHR PSIKKANAKPVRNIPKPAPEEKMCRSTMRALAQAQAQGTSEGGTADSPNTTPKSSSPLPSFARNTVASTS RSKKDMPSATVTGTPSKSLSRTSSQRLPGGRTESVSSGPLPRSEDKLGGSIRRVQSVRASSRSSDTPSQSG RDHSLKSSSFSDRSTPTRDTIISSRTSKPTWK

Future Directions Clone for expression Protein binding studies

Acknowledgements Josh McBride Aric Elmer OUR