Universiteit Utrecht BLAST CD Session 2 | Wednesday 4 May 2005 Bram Raats Lee Provoost.

Slides:



Advertisements
Similar presentations
Indexing DNA Sequences Using q-Grams
Advertisements

Fa07CSE 182 CSE182-L4: Database filtering. Fa07CSE 182 Summary (through lecture 3) A2 is online We considered the basics of sequence alignment –Opt score.
Blast outputoutput. How to measure the similarity between two sequences Q: which one is a better match to the query ? Query: M A T W L Seq_A: M A T P.
Gapped BLAST and PSI-BLAST Altschul et al Presenter: 張耿豪 莊凱翔.
Alignment methods Introduction to global and local sequence alignment methods Global : Needleman-Wunch Local : Smith-Waterman Database Search BLAST FASTA.
BLAST Sequence alignment, E-value & Extreme value distribution.
Gapped Blast and PSI BLAST Basic Local Alignment Search Tool ~Sean Boyle Basic Local Alignment Search Tool ~Sean Boyle.
1 CAP5510 – Bioinformatics Database Searches for Biological Sequences or Imperfect Alignments Tamer Kahveci CISE Department University of Florida.
Introduction to Bioinformatics
Local alignments Seq X: Seq Y:. Local alignment  What’s local? –Allow only parts of the sequence to match –Results in High Scoring Segments –Locally.
Searching Sequence Databases
. Class 4: Fast Sequence Alignment. Alignment in Real Life u One of the major uses of alignments is to find sequences in a “database” u Such collections.
Heuristic alignment algorithms and cost matrices
We continue where we stopped last week: FASTA – BLAST
Overview of sequence database searching techniques and multiple alignment May 1, 2001 Quiz on May 3-Dynamic programming- Needleman-Wunsch method Learning.
. Class 4: Fast Sequence Alignment. Alignment in Real Life u One of the major uses of alignments is to find sequences in a “database” u Such collections.
1 1. BLAST (Basic Local Alignment Search Tool) Heuristic Only parts of protein are frequently subject to mutations. For example, active sites (that one.
Pairwise Sequence Alignment Part 2. Outline Global alignments-continuation Local versus Global BLAST algorithms Evaluating significance of alignments.
Alignment methods June 26, 2007 Learning objectives- Understand how Global alignment program works. Understand how Local alignment program works.
Similar Sequence Similar Function Charles Yan Spring 2006.
Sequence Alignment III CIS 667 February 10, 2004.
Heuristic Approaches for Sequence Alignments
Bioinformatics Unit 1: Data Bases and Alignments Lecture 3: “Homology” Searches and Sequence Alignments (cont.) The Mechanics of Alignments.
Practical algorithms in Sequence Alignment Sushmita Roy BMI/CS 576 Sep 16 th, 2014.
Sequence similarity. Motivation Same gene, or similar gene Suffix of A similar to prefix of B? Suffix of A similar to prefix of B..Z? Longest similar.
Dynamic Programming. Pairwise Alignment Needleman - Wunsch Global Alignment Smith - Waterman Local Alignment.
Sequence alignment, E-value & Extreme value distribution
Alignment methods II April 24, 2007 Learning objectives- 1) Understand how Global alignment program works using the longest common subsequence method.
Sequence comparison: Significance of similarity scores Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas.
Heuristic methods for sequence alignment in practice Sushmita Roy BMI/CS 576 Sushmita Roy Sep 27 th,
Bioinformatics and BLAST
Alignment Statistics and Substitution Matrices BMI/CS 576 Colin Dewey Fall 2010.
Pairwise Alignment How do we tell whether two sequences are similar? BIO520 BioinformaticsJim Lund Assigned reading: Ch , Ch 5.1, get what you can.
Biostatistics-Lecture 15 High-throughput sequencing and sequence alignment Ruibin Xi Peking University School of Mathematical Sciences.
Gapped BLAST and PSI-BLAST : a new generation of protein database search programs Team2 邱冠儒 黃尹柔 田耕豪 蕭逸嫻 謝朝茂 莊閔傑 2014/05/12 1.
An Introduction to Bioinformatics
Gapped BLAST and PSI- BLAST: a new generation of protein database search programs By Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui.
Classifier Evaluation Vasileios Hatzivassiloglou University of Texas at Dallas.
Molecular phylogenetics 1 Level 3 Molecular Evolution and Bioinformatics Jim Provan Page and Holmes: Sections
Sequence Alignment Goal: line up two or more sequences An alignment of two amino acid sequences: …. Seq1: HKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITN-EYMKEDFLIKIETWHKP.
Searching Molecular Databases with BLAST. Basic Local Alignment Search Tool How BLAST works Interpreting search results The NCBI Web BLAST interface Demonstration.
Database Searches BLAST. Basic Local Alignment Search Tool –Altschul, Gish, Miller, Myers, Lipman, J. Mol. Biol. 215 (1990) –Altschul, Madden, Schaffer,
Last lecture summary. Window size? Stringency? Color mapping? Frame shifts?
BLAST Anders Gorm Pedersen & Rasmus Wernersson. Database searching Using pairwise alignments to search databases for similar sequences Database Query.
Chapter 3 Computational Molecular Biology Michael Smith
BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha.
Sequence Comparison Algorithms Ellen Walker Bioinformatics Hiram College.
BLAST Slides adapted & edited from a set by Cheryl A. Kerfeld (UC Berkeley/JGI) & Kathleen M. Scott (U South Florida) Kerfeld CA, Scott KM (2011) Using.
Pairwise Local Alignment and Database Search Csc 487/687 Computing for Bioinformatics.
Finding Sequence Similarities >query AGACGAACCTAGCACAAGCGCGTCTGGAAAGACCCGCCAGCTACGGTCACCGAG CTTCTCATTGCTCTTCCTAACAGTGTGATAGGCTAACCGTAATGGCGTTCAGGA GTATTTGGACTGCAATATTGGCCCTCGTTCAAGGGCGCCTACCATCACCCGACG.
Constructing Probability Matrices Redux Suppose we live in a world with only 3 amino acids: Alanine Leucine Serine Furthermore suppose: Alanine Leucine.
Pairwise Sequence Alignment Part 2. Outline Summary Local and Global alignments FASTA and BLAST algorithms Evaluating significance of alignments Alignment.
Heuristic Methods for Sequence Database Searching BMI/CS 576 Colin Dewey Fall 2015.
Sequence Alignment.
Doug Raiford Phage class: introduction to sequence databases.
Finding Sequence Similarities >query AGACGAACCTAGCACAAGCGCGTCTGGAAAGACCCGCCAGCTACGGTCACCGAG CTTCTCATTGCTCTTCCTAACAGTGTGATAGGCTAACCGTAATGGCGTTCAGGA GTATTTGGACTGCAATATTGGCCCTCGTTCAAGGGCGCCTACCATCACCCGACG.
Step 3: Tools Database Searching
Heuristic Methods for Sequence Database Searching BMI/CS 576 Colin Dewey Fall 2010.
Heuristic Alignment Algorithms Hongchao Li Jan
BLAST: Database Search Heuristic Algorithm Some slides courtesy of Dr. Pevsner and Dr. Dirk Husmeier.
Your friend has a hobby of generating random bit strings, and finding patterns in them. One day she come to you, excited and says: I found the strangest.
9/6/07BCB 444/544 F07 ISU Dobbs - Lab 3 - BLAST1 BCB 444/544 Lab 3 BLAST Scoring Matrices & Alignment Statistics Sept6.
Database Scanning/Searching FASTA/BLAST/PSIBLAST G P S Raghava.
Blast Basic Local Alignment Search Tool
BLAST Anders Gorm Pedersen & Rasmus Wernersson.
Welcome to Introduction to Bioinformatics
Fast Sequence Alignments
Basic Local Alignment Search Tool
Sequence alignment, E-value & Extreme value distribution
Searching Sequence Databases
Presentation transcript:

Universiteit Utrecht BLAST CD Session 2 | Wednesday 4 May 2005 Bram Raats Lee Provoost

Universiteit Utrecht Introduction in BLAST BLAAT Explain also the HSP of Bogdan’s first question. Base on “Sequence similarity search PDF document that Bram found.

Universiteit Utrecht Lee | Peter #1: Question At Page 79 it is mentioned that NCBI BLAST, with a minimum word length of 7, does not use the two-hit algorithm. Since it would be useful to use the two-hit algorithm for smaller word sizes, is it possible to use the algorithm anyway, but then with smaller word sizes, and translate this information afterwards to longer words?

Universiteit Utrecht Lee | Peter #1: Answer Two-hit algorithm uses Word size (W) and Treshold (T), but BLASTN seeds are always identical words, so only based on Word size (W). Two-hit algorithms aren’t used in BLASTN searches because word hits are usually rare with large identical words (NCBI- BLASTN requires minimum W = 7) BUT! Why BLASTN W >=7, while BLASTP W = 3? Why not BLASTN W = 3? -> # sizes in available data -> hash table puts memory constraints

Universiteit Utrecht Lee | Peter #2: Question At page 83 a floating/fixed bandwidth is mentioned i.c.w. gapped extension. What does this bandwidth mean and how is it used for the extension procedure?

Universiteit Utrecht Lee | Peter #2: Answer Bandwidth: Window width (or band width) within which gapped alignments are generated. Default for protein comparisons: 32 Default for nucleotide comparisons: 16

Universiteit Utrecht Lee | Ingmar #1: Question I have the following question for you. On page 79 they are talking about a two-hit algorithm that looks for places where words are found within a given distance. In this way they want to reduce the search space. My question is why this is so useful, since when you are aligning a big string, it seems to me that even the two-hit strategy would be able to find a lot of useless seeds. Would it be useful to try a thee-hit or even four-hit strategy in this case? It seems to me that you could cut off the search space even further then.

Universiteit Utrecht Lee | Ingmar #1: Answer BLAST 1 used a one-hit algorithm, but the nowadays used BLAST 2 uses the two-hit algorithm. Extension step typically accounts for 90 % of BLAST’s execution time Word hits tend to cluster along diagonals in the search space --> the two-hit algorithm takes advantage of that by requiring two word hits on the same diagonal within a given distance But! To obtain the same sensitivity we have to lower the T, which causes more additional neighborhood words --> more computation So: 3 and 4 hit algorithms wouldn’t be beneficial due to an even lower T + we ignore a lot of possible candidates!

Universiteit Utrecht Lee | Bogdan #1: Question The notion of HSP (high scoring pair) is used widely throughout the last part of the chapter about statistical models used in BLAST. However, it is never quite clearly explained. It’s supposed to be a pair with a high score. But what is this “high score”? Is it some sort of threshold? This is the only interpretation I can think of. However, if it is so, then what is the “expected HSP length” defined and used in the section called “Length Correction”? Is it supposed to be the length of a pair of matched sequences, in which all the corresponding pairs have the score above the possible threshold? Could you maybe explain this by an example of some sort, since I’ve read the section over and over and it still doesn’t fall into place. I seem to miss the intuition behind the significance of the HSP length.

Universiteit Utrecht Lee | Bogdan #1: Answer Once seeds are extended in both directions to create alignments, the alignments are evaluated to determine if they are statistically significant. Those that are significant are called HSP’s. Evaluation: just use some threshold, to sort alignments into low and high scoring

Universiteit Utrecht Lee | Bogdan #2: Question Have a look at the section called “Sum statistics and Sum scores”. We have a series of more and more accurate defined sums defined there. The part I don’t understand is why these sums are needed. I mean, we have the Needleman-Wunsch and the Smith-Waterman algorithms to get the best alignments for two algorithms in order to get the pair with the best score? Why would we want to keep computing sum scores for pairs of alignment, when we could simply detect the alignment with the best score (assuming we have the score matrix) directly?

Universiteit Utrecht Lee | Bogdan #2: Answer Needleman-Wunsch & Smith-Waterman dynamic programming algorithm Explores entire search space between two sequences BLAST heuristic algorithm Minimizing search space is key to its speed but at the cost of a loss in sensitivity --> SW = 10 min | BLAST = 20 sec Remark: BLAST based on SW! (

Universiteit Utrecht Lee | Bogdan #3: Question At some point in the evaluation part of the BLAST algorithms it is mentioned that HSP’s have to be organized into consistent groups. I understand the upper left - bottom right argument about consistent groups, but it doesn’t seem to be enough, in my opinion, for a complete definition of such groups. What more is there which the algorithm has to look at in order to decide how exactly a consistent group is supposed to be formed. For example, I don’t think that a group should consist of HSP’s which are very far apart, even if they conform to the upper left - bottom right criteria. Or am I not understanding things in the right way?

Universiteit Utrecht Lee | Bogdan #3: Answer The relationship between HSP’s should resemble the relationship between ungapped alignments. The lines in the graph should start from the upper left and continue to the lower right, the lines shouldn't overlap, and there should be a penalty for unaligned sequence. Groups of HSP’s that behave this way are considered consistent. “Some” algorithm for defining groups of consistent HSP’s Coordinates -> overlapping? Band width?

Universiteit Utrecht Jacob #1: Question I sort of understand why it is nice to have a pair-wise ordered sum score like Equation 4- 17, but why is the ln(r!) added to the sum? I don’t see how this adds the ordering to the sum.

Universiteit Utrecht Jacob #1: Answer Error in book? Ln(r!) is additional bonus points for collinear HSP’s Exact meaning?

Universiteit Utrecht Bram | Jacob #2: Question On page 79 it is said that it looks like the word hits tend to cluster along diagonals in the search space. Why, in what way, is this and advantage for the two hit algorithm?

Universiteit Utrecht Bram | Jacob #2: Answer 2 word hits on same diagonal within distance Search space reduced -> increase speed

Universiteit Utrecht Bram | Marjolijn #1: Question PAM matrices are based on data available in the 1970’s, and BLOSSUM matrices are based on data available in the 1990’s. Can PAM and BLOSSUM produce the same score of alignment for two sequences when you choose the correct number i for PAMi and BLOSSUMi?

Universiteit Utrecht Bram | Marjolijn #1: Answer PAM Theoretical attempt to model the course of sequence evolution. BLOSSUM empirical Using the relative entropy of a scoring matrix (H) -> compare the two different matrices. If the general behaviour of a scoring matrix is the same, the probabilitiy of an equal score of alignment is high. So when you choose the correct number i, for PAM and BLOSSUM, they should produce the same score of alignment.

Universiteit Utrecht Bram | Marjolijn #2: Question BLAST searches for statistically significant similarities. How did BLAST learn which similarities between two sequences are statistically significant and which are not? Is the learn-set of sequences the whole DNA database or not?

Universiteit Utrecht Bram | Marjolijn #2: Answer BLAST uses the scores of the different alignments found to determine if an alignment is statistically significant or not. Significant alignments are called HSP’s. At the simplest level, BLAST uses a score threshold S, to sort alignments in high and low scoring. Because S and E are related through the Karlin-Altschul equation, a score threshold is synonymous with a statistical threshold. So BLAST uses scoring matrices to determine the score of a specific alignment and uses a threshold to determine if the score of the alignment is high enough to be statistically significant.

Universiteit Utrecht Laurence #1: Question On page 65 it says that the Karlin-Altschul theory makes five central assumptions, one of these is that the sequences are infinitely long, I don’t really understand why it is necessary for the sequence to be infinitely long. Can you please explain it?

Universiteit Utrecht Laurence #1: answer ?