DNA. DNA is read from 5’ end DNA close up Central Dogma.

Slides:



Advertisements
Similar presentations
Proteins: Structure reflects function….. Fig. 5-UN1 Amino group Carboxyl group carbon.
Advertisements

Review.
Amino Acids PHC 211.  Characteristics and Structures of amino acids  Classification of Amino Acids  Essential and Nonessential Amino Acids  Levels.
A Ala Alanine Alanine is a small, hydrophobic
Aminoácidos Unidad de las proteínas. Isómeros Clasificación Esenciales Valina (Val) Leucina (Leu) Isoleucina (Ile) Fenilalanina (Phe) Metionina (Met)
Metabolic fuels and Dietary components Lecture - 2 By Dr. Abdulrahman Al-Ajlan.
• Exam II Tuesday 5/10 – Bring a scantron with you!
5’ C 3’ OH (free) 1’ C 5’ PO4 (free) DNA is a linear polymer of nucleotide subunits joined together by phosphodiester bonds - covalent bonds between.
RNA Say Hello to DNA’s little friend!. EngageEssential QuestionExplain Describe yourself to long lost uncle. How do the mechanisms of genetics and the.
Lectures on Computational Biology HC Lee Computational Biology Lab Center for Complex Systems & Biophysics National Central University EFSS II National.
Amino Acids, Peptides, Protein Primary Structure Chapter 3.
Amino Acids, Peptides, Protein Primary Structure
© 2010 Pearson Education, Inc. Lectures by Chris C. Romero, updated by Edward J. Zalisko PowerPoint ® Lectures for Campbell Essential Biology, Fourth Edition.
Amino Acids, Peptides, Protein Primary Structure
FIGURE (part 2) Urea cycle and reactions that feed amino groups into the cycle. The enzymes catalyzing these reactions (named in the text) are distributed.
Molecular Techniques in Molecular Systematics. DNA-DNA hybridisation -Measures the degree of genetic similarity between pools of DNA sequences. -Normally.
Exciting Developments in Molecular Biology As seen by an amateur.
©CMBI 2001 A Ala Alanine Alanine is a small, hydrophobic residue. Its side chain, R, is just a methyl group. Alanine likes to sit in an alpha helix,it.
You Must Know How the sequence and subcomponents of proteins determine their properties. The cellular functions of proteins. (Brief – we will come back.
Amino Acids, Peptides, and Proteins.. Classification of Amino Acids.
Chapter 27 Amino Acids, Peptides, and Proteins. Nucleic Acids.
Proteins and Enzymes Nestor T. Hilvano, M.D., M.P.H. (Images Copyright Discover Biology, 5 th ed., Singh-Cundy and Cain, Textbook, 2012.)
1.What makes an enzyme specific to one type of reaction (in other words, what determines the function of a protein)? –SHAPE determines the function of.
Unit 7 RNA, Protein Synthesis & Gene Expression Chapter 10-2, 10-3
How does DNA work? What is a gene?
Protein Synthesis. DNA RNA Proteins (Transcription) (Translation) DNA (genetic information stored in genes) RNA (working copies of genes) Proteins (functional.
CHAPTER 12 PROTEIN SYNTHESIS AND MUTATIONS -RNA -PROTEIN SYNTHESIS -MUTATIONS.
©CMBI 2006 Amino Acids “ When you understand the amino acids, you understand everything ”
How Proteins Are Made Mrs. Wolfe. DNA: instructions for making proteins Proteins are built by the cell according to your DNA What kinds of proteins are.
. Sequence Alignment. Sequences Much of bioinformatics involves sequences u DNA sequences u RNA sequences u Protein sequences We can think of these sequences.
PROTEIN SYNTHESIS NOTES #1. Review What is transcription? Copying of DNA onto mRNA Where does transcription occur? In the Nucleus When copying DNA onto.
© 2010 Pearson Education, Inc. Lectures by Chris C. Romero, updated by Edward J. Zalisko PowerPoint ® Lectures for Campbell Essential Biology, Fourth Edition.
LESSON 4: Using Bioinformatics to Analyze Protein Sequences PowerPoint slides to accompany Using Bioinformatics : Genetic Research.
AMINO ACIDS.
WSSP Chapter 8 BLASTX Translated DNA vs Protein searches atttaccgtg ttggattgaa attatcttgc atgagccagc tgatgagtat gatacagttt tccgtattaa taacgaacgg ccggaaatag.
Amino Acids are the building units of proteins
Learning Targets “I Can...” -State how many nucleotides make up a codon. -Use a codon chart to find the corresponding amino acid.
Fig Second mRNA base First mRNA base (5 end of codon) Third mRNA base (3 end of codon)
Welcome Back! February 27, 2012 Sit in any seat for today. You will have assigned seats tomorrow Were you absent before the break? Plan on coming to tutorial.
intro-VIRUSES Virus NamePDB ID HUMAN PAPILLOMAVIRUS 161DZL BACTERIOPHAGE GA1GAV L-A virus1M1C SATELLITE PANICUM MOSAIC VIRUS1STM SATELLITE TOBACCO NECROSIS2BUK.
CELL REPRODUCTION: MITOSIS INTERPHASE: DNA replicates PROPHASE: Chromatin condenses into chromosomes, centrioles start migrating METAPHASE: chromosomes.
End Show Slide 1 of 39 Copyright Pearson Prentice Hall 12-3 RNA and Protein Synthesis 12–3 RNA and Protein Synthesis.
RNA 2 Translation.
Transcription and Translation
Amino Acids ©CMBI 2001 “ When you understand the amino acids, you understand everything ”
Proteins.
Chapter 3 Proteins.
M3/31EXAM IIChapters 8-12, parts of 2, 3 W4/2Transcription and TranslationChapters 4, 15 M4/7"Molecular" GeneticsChapter 16 W4/9"Classical" GeneticsChapter.
Amino Acids  Amino Acids are the building units of proteins. Proteins are polymers of amino acids linked together by what is called “ Peptide bond” (see.
Parts is parts…. AMINO ACID building block of proteins contain an amino or NH 2 group and a carboxyl (acid) or COOH group PEPTIDE BOND covalent bond link.
Amino acids Common structure of 19 AAs H3N+H3N+ COO - R H C Proline.
Genomics Lecture 3 By Ms. Shumaila Azam. Proteins Proteins: large molecules composed of one or more chains of amino acids, polypeptides. Proteins are.
Proteins Tertiary Protein Structure of Enzyme Lactasevideo Video 2.
Amino acids.
Translation PROTEIN SYNTHESIS.
Whole process Step by step- from chromosomes to proteins.
Please turn in your homework
Protein Synthesis: Translation
BIOLOGY 12 Protein Synthesis.
Fig. 5-UN1  carbon Amino group Carboxyl group.
Today’s notes from the student table Something to write with
Proteins Genetic information in DNA codes specifically for the production of proteins Cells have thousands of different proteins, each with a specific.
The 20 amino acids.
Translation.
Replication, Transcription, Translation PRACTICE
The 20 amino acids.
Replication, Transcription, Translation PRACTICE
Replication, Transcription, Translation PRACTICE
Example of regression by RBF-ANN
“When you understand the amino acids,
Presentation transcript:

DNA

DNA is read from 5’ end

DNA close up

Central Dogma

Symbol 3-letter Meaning Codons A Ala Alanine GCT,GCC,GCA,GCG C Cys Cysteine TGT,TGC D Asp Aspartic GAT,GAC E Glu Glutamic GAA,GAG F Phe Phenylalanine TTT,TTC G Gly Glycine GGT,GGC,GGA,GGG H His Histidine CAT,CAC I Ile Isoleucine ATT,ATC,ATA K Lys Lysine AAA,AAG L Leu Leucine TTG,TTA,CTT,CTC,CTA,CTG M Met Methionine ATG N Asn Asparagine AAT,AAC P Pro Proline CCT,CCC,CCA,CCG Q Gln Glutamine CAA,CAG R Arg Arginine CGT,CGC,CGA,CGG,AGA,AGG S Ser Serine TCT,TCC,TCA,TCG,AGT,AGC T Thr Threonine ACT,ACC,ACA,ACG V Val Valine GTT,GTC,GTA,GTG W Trp Tryptophan TGG X Xxx Unknown Y Tyr Tyrosine TAT, TAC * End Terminator TAA,TAG,TGA

Binding of RNA polymerase at start of transcription

Transcription

Transcription (con’t)

Transcription complete

tRNA

Translation

E. coli dUTPase MKKIDVKILDPRVGKEFPLPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLA IHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDSFTI QPGERIAQMIFVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ 1 atgaaaaaaa tcgacgttaa gattctggac ccgcgcgttg ggaaggaatt tccgctcccg 61 acttatgcca cctctggctc tgccggactt gacctgcgtg cctgtctcaa cgacgccgta 121 gaactggctc cgggtgacac tacgctggtt ccgaccgggc tggcgattca tattgccgat 181 ccttcactgg cggcaatgat gctgccgcgc tccggattgg gacataagca cggtatcgtg 241 cttggtaacc tggtaggatt gatcgattct gactatcagg gccagttgat gatttccgtg 301 tggaaccgtg gtcaggacag cttcaccatt caacctggcg aacgcatcgc ccagatgatt 361 tttgttccgg tagtacaggc tgaatttaat ctggtggaag atttcgacgc caccgaccgc 421 ggtgaaggcg gctttggtca ctctggtcgt cagtaa

Polysomal translation

lac operon

Regulatory gene, i, codes for repressor protein

Can also have enhancers