1 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu BIOINFORMATICS Structures Mark Gerstein, Yale University bioinfo.mbb.yale.edu/mbb452a.

Slides:



Advertisements
Similar presentations
Alignment methods Introduction to global and local sequence alignment methods Global : Needleman-Wunch Local : Smith-Waterman Database Search BLAST FASTA.
Advertisements

Measuring the degree of similarity: PAM and blosum Matrix
Lecture 8 Alignment of pairs of sequence Local and global alignment
Prediction to Protein Structure Fall 2005 CSC 487/687 Computing for Bioinformatics.
1 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu BIOINFORMATICS Introduction Mark Gerstein, Yale University bioinfo.mbb.yale.edu/mbb452a.
Structural bioinformatics
Optimatization of a New Score Function for the Detection of Remote Homologs Kann et al.
Heuristic alignment algorithms and cost matrices
Proteins  Proteins control the biological functions of cellular organisms  e.g. metabolism, blood clotting, immune system amino acids  Building blocks.
Scoring Matrices June 22, 2006 Learning objectives- Understand how scoring matrices are constructed. Workshop-Use different BLOSUM matrices in the Dotter.
The Protein Data Bank (PDB)
Introduction to bioinformatics
1 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Several motifs (  -sheet, beta-alpha-beta, helix-loop-helix) combine to form a compact globular.
Protein threading Structure is better conserved than sequence
Alignment methods June 26, 2007 Learning objectives- Understand how Global alignment program works. Understand how Local alignment program works.
Similar Sequence Similar Function Charles Yan Spring 2006.
Recap 3 different types of comparisons 1. Whole genome comparison 2. Gene search 3. Motif discovery (shared pattern discovery)
A unified statistical framework for sequence comparison and structure comparison Michael Levitt Mark Gerstein.
Structure Alignment in Polynomial Time Rachel Kolodny Stanford University Nati Linial The Hebrew University of Jerusalem.
Computational Biology, Part 2 Sequence Comparison with Dot Matrices Robert F. Murphy Copyright  1996, All rights reserved.
Model Database. Scene Recognition Lamdan, Schwartz, Wolfson, “Geometric Hashing”,1988.
Alignment methods II April 24, 2007 Learning objectives- 1) Understand how Global alignment program works using the longest common subsequence method.
Protein Structures.
TM Biological Sequence Comparison / Database Homology Searching Aoife McLysaght Summer Intern, Compaq Computer Corporation Ballybrit Business Park, Galway,
IBGP/BMI 705 Lab 4: Protein structure and alignment TA: L. Cooper.
Computational Structure Prediction Kevin Drew BCH364C/391L Systems Biology/Bioinformatics 2/12/15.
Structural alignment Protein structure Every protein is defined by a unique sequence (primary structure) that folds into a unique.
An Introduction to Bioinformatics
Chapter 9 Superposition and Dynamic Programming 1 Chapter 9 Superposition and dynamic programming Most methods for comparing structures use some sorts.
1 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu BIOINFORMATICS Structures Mark Gerstein, Yale University bioinfo.mbb.yale.edu/mbb452a.
Computational Biology, Part 3 Sequence Alignment Robert F. Murphy Copyright  1996, All rights reserved.
Evolution and Scoring Rules Example Score = 5 x (# matches) + (-4) x (# mismatches) + + (-7) x (total length of all gaps) Example Score = 5 x (# matches)
PDBe-fold (SSM) A web-based service for protein structure comparison and structure searches Gaurav Sahni, Ph.D.
RNA Secondary Structure Prediction Spring Objectives  Can we predict the structure of an RNA?  Can we predict the structure of a protein?
Sequence analysis: Macromolecular motif recognition Sylvia Nagl.
Pairwise Sequence Alignment. The most important class of bioinformatics tools – pairwise alignment of DNA and protein seqs. alignment 1alignment 2 Seq.
Comp. Genomics Recitation 3 The statistics of database searching.
Protein Structure Comparison. Sequence versus Structure The protein sequence is a string of letters: there is an optimal solution (DP) to the problem.
Function preserves sequences Christophe Roos - MediCel ltd Similarity is a tool in understanding the information in a sequence.
Protein Classification II CISC889: Bioinformatics Gang Situ 04/11/2002 Parts of this lecture borrowed from lecture given by Dr. Altman.
BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha.
Module 3 Protein Structure Database/Structure Analysis Learning objectives Understand how information is stored in PDB Learn how to read a PDB flat file.
A data-mining approach for multiple structural alignment of proteins WY Siu, N Mamoulis, SM Yiu, HL Chan The University of Hong Kong Sep 9, 2009.
1 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu BIOINFORMATICS Structures Mark Gerstein, Yale University bioinfo.mbb.yale.edu/mbb452a (last edit.
Protein Structure Prediction: Homology Modeling & Threading/Fold Recognition D. Mohanty NII, New Delhi.
Protein Folding & Biospectroscopy Lecture 6 F14PFB David Robinson.
Pairwise Sequence Alignment Part 2. Outline Summary Local and Global alignments FASTA and BLAST algorithms Evaluating significance of alignments Alignment.
Pairwise sequence alignment Lecture 02. Overview  Sequence comparison lies at the heart of bioinformatics analysis.  It is the first step towards structural.
Sequence Alignment.
Step 3: Tools Database Searching
V diagonal lines give equivalent residues ILS TRIVHVNSILPSTN V I L S T R I V I L P E F S T Sequence A Sequence B Dot Plots, Path Matrices, Score Matrices.
V diagonal lines give equivalent residues ILS TRIVHVNSILPSTN V I L S T R I V I L P E F S T Sequence A Sequence B Dot Plots, Path Matrices, Score Matrices.
EMBL-EBI Eugene Krissinel SSM - MSDfold. EMBL-EBI MSDfold (SSM)
Find the optimal alignment ? +. Optimal Alignment Find the highest number of atoms aligned with the lowest RMSD (Root Mean Squared Deviation) Find a balance.
1 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Several motifs (  -sheet, beta-alpha-beta, helix-loop-helix) combine to form a compact globular.
Substitution Matrices and Alignment Statistics BMI/CS 776 Mark Craven February 2002.
EBI is an Outstation of the European Molecular Biology Laboratory. PDBe-fold (SSM) A web-based service for protein structure comparison and structure searches.
Protein Structure Comparison
Bioinformatics Biological Data Computer Calculations +
Large-Scale Genomic Surveys
Protein Structures.
BIOINFORMATICS Introduction
BIOINFORMATICS Summary
Protein structure prediction.
BIOINFORMATICS Sequence Comparison
Sequence alignment, E-value & Extreme value distribution
Presentation transcript:

1 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu BIOINFORMATICS Structures Mark Gerstein, Yale University bioinfo.mbb.yale.edu/mbb452a

2 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Contents: Structures What Structures Look Like? Structural Alignment by Iterated Dynamic Programming  RMS Superposition Scoring Structural Similarity Other Aspects of Structural Alignment  Distance Matrix based methods

3 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Molecular Biology Information: Macromolecular Structure DNA/RNA/Protein  Almost all protein (RNA Adapted From D Soll Web Page, Right Hand Top Protein from M Levitt web page)

4 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Molecular Biology Information: Protein Structure Details Statistics on Number of XYZ triplets  200 residues/domain -> 200 CA atoms, separated by 3.8 A  Avg. Residue is Leu: 4 backbone atoms + 4 sidechain atoms, 150 cubic A o=> ~1500 xyz triplets (=8x200) per protein domain  10 K known domain, ~300 folds ATOM 1 C ACE GKY 67 ATOM 2 O ACE GKY 68 ATOM 3 CH3 ACE GKY 69 ATOM 4 N SER GKY 70 ATOM 5 CA SER GKY 71 ATOM 6 C SER GKY 72 ATOM 7 O SER GKY 73 ATOM 8 CB SER GKY 74 ATOM 9 OG SER GKY 75 ATOM 10 N ARG GKY 76 ATOM 11 CA ARG GKY 77 ATOM 12 C ARG GKY ATOM 1444 CB LYS GKY1510 ATOM 1445 CG LYS GKY1511 ATOM 1446 CD LYS GKY1512 ATOM 1447 CE LYS GKY1513 ATOM 1448 NZ LYS GKY1514 ATOM 1449 OXT LYS GKY1515 TER 1450 LYS 186 1GKY1516

5 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Other Aspects of Structure, Besides just Comparing Atom Positions Atom Position, XYZ triplets Lines, Axes, Angles Surfaces, Volumes

6 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu What is Protein Geometry? Coordinates (X, Y, Z’s) Derivative Concepts  Distance, Surface Area, Volume, Cavity, Groove, Axes, Angle, &c Relation to  Function, Energies (E(x)), Dynamics (dx/dt)

7 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Depicting Protein Structure: Sperm Whale Myoglobin

8 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Incredulase

9 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Structure alignment - Method What Structures Look Like? Structural Alignment by Iterated Dynamic Programming  RMS Superposition Scoring Structural Similarity Other Aspects of Structural Alignment  Distance Matrix based methods  Fold Library Relation of Sequence Similarity to Structural and Functional Similarity Protein Geometry Surface I (Calculation) Calculation of Volume Voronoi Volumes & Packing Standard Volumes & Radii Surfaces II (Relationship to Volumes) Other Applications of Volumes -- Motions, Docking

10 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Sperm Whale Myoglobin

11 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Structural Alignment of Two Globins

12 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Automatic Alignment to Build Fold Library Hb Mb Alignment of Individual Structures Fusing into a Single Fold “Template” Hb VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSAQVKGHGKKVADALTNAV |||.. | |.|| |. |. | | | | | | |.|.| || | ||. Mb VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAIL Hb AHVD-DMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR | |. || |....|.. | |..|.. | |. ||. Mb KK-KGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG Elements: Domain definitions; Aligned structures, collecting together Non-homologous Sequences; Core annotation Previous work: Remington, Matthews ‘80; Taylor, Orengo ‘89, ‘94; Artymiuk, Rice, Willett ‘89; Sali, Blundell, ‘90; Vriend, Sander ‘91; Russell, Barton ‘92; Holm, Sander ‘93 ; Godzik, Skolnick ‘94; Gibrat, Madej, Bryant ‘96; Falicov, F Cohen, ‘96; Feng, Sippl ‘96; G Cohen ‘97; Singh & Brutlag, ‘98

13 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Automatically Comparing Protein Structures Given 2 Structures (A & B), 2 Basic Comparison Operations 1Given an alignment optimally SUPERIMPOSE A onto B Find Best R & T to move A onto B 2Find an Alignment between A and B based on their 3D coordinates

14 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu RMS Superposition (1) A B

15 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu RMS Superposition (2): Distance Between an Atom in 2 Structures

16 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu RMS Superposition (3): RMS Distance Between Aligned Atoms in 2 Structures

17 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu RMS Superposition (4): Rigid-Body Rotation and Translation of One Structure (B)

18 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu RMS Superposition (5): Optimal Movement of One Structure to Minimize the RMS Methods of Solution: springs (F ~ kx) SVD Kabsch

19 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Alignment (1) Make a Similarity Matrix (Like Dot Plot)

20 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Structural Alignment (1b) Make a Similarity Matrix (Generalized Similarity Matrix) PAM(A,V) = 0.5  Applies at every position i, J)  Specific Matrix for each pair of residues i in protein 1 and J in protein 2  Example is Y near N-term. matches any C-term. residue (Y at J=2) S(i,J)  Doesn’t need to depend on a.a. identities at all!  Just need to make up a score for matching residue i in protein 1 with residue J in protein 2 J i

21 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Structural Alignment (1c*) Similarity Matrix for Structural Alignment Structural Alignment  Similarity Matrix S(i,J) depends on the 3D coordinates of residues i and J  Distance between CA of i and J  M(i,j) = 100 / (5 + d 2 ) Threading  S(i,J) depends on the how well the amino acid at position i in protein 1 fits into the 3D structural environment at position J of protein 2

22 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Alignment (2): Dynamic Programming, Start Computing the Sum Matrix new_value_cell(R,C) <= cell(R,C) { Old value, either 1 or 0 } + Max[ cell (R+1, C+1), { Diagonally Down, no gaps } cells(R+1, C+2 to C_max),{ Down a row, making col. gap } cells(R+2 to R_max, C+2) { Down a col., making row gap } ]

23 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Alignment (3):Dynamic Programming, Keep Going

24 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Alignment (4): Dynamic Programming, Sum Matrix All Done

25 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Alignment (5): Traceback Find Best Score (8) and Trace Back A B C N Y - R Q C L C R - P M A Y C - Y N R - C K C R B P

26 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu In Structural Alignment, Not Yet Done (Step 6*) Use Alignment to LSQ Fit Structure B onto Structure A  However, movement of B will now change the Similarity Matrix This Violates Fundamental Premise of Dynamic Programming  Way Residue at i is aligned can now affect previously optimal alignment of residues (from 1 to i-1) ACSQRP--LRV-SH -R SENCV A-SNKPQLVKLMTH VK DFCV-

27 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Structural Alignment (7*), Iterate Until Convergence 1Compute Sim. Matrix 2Align via Dyn. Prog. 3RMS Fit Based on Alignment 4Move Structure B 5 Re-compute Sim. Matrix 6If changed from #1, GOTO #2

28 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Structure alignment - Scoring What Structures Look Like? Structural Alignment by Iterated Dynamic Programming  RMS Superposition Scoring Structural Similarity Other Aspects of Structural Alignment  Distance Matrix based methods  Fold Library Relation of Sequence Similarity to Structural and Functional Similarity Protein Geometry Surface I (Calculation) Calculation of Volume Voronoi Volumes & Packing Standard Volumes & Radii Surfaces II (Relationship to Volumes) Other Applications of Volumes -- Motions, Docking

29 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Score S at End Just Like SW Score, but also have final RMS S = Total Score S(i,j) = similarity matrix score for aligning i and j Sum is carried out over all aligned i and j n = number of gaps (assuming no gap ext. penalty) G = gap penalty

30 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Some Similarities are Readily Apparent others are more Subtle Easy: Globins 125 res., ~1.5 Å Tricky: Ig C & V 85 res., ~3 Å Very Subtle: G3P-dehydro- genase, C-term. Domain >5 Å

31 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Some Similarities are Readily Apparent others are more Subtle Easy: Globins 125 res., ~1.5 Å Tricky: Ig C & V 85 res., ~3 Å Very Subtle: G3P-dehydro- genase, C-term. Domain >5 Å

32 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Significance Statistics  For sequences, originally used in Blast (Karlin-Altschul). Then in FASTA, &c.  Extrapolated Percentile Rank: How does a Score Rank Relative to all Other Scores? Our Strategy: Fit to Observed Distribution 1)All-vs-All comparison 2)Graph Distribution of Scores in 2D (N dependence); 1K x 1K families -> ~1M scores; ~2K included TPs 3)Fit a function  (S) to TN distribution (TNs from scop); Integrating  gives P(s>S), the CDF, chance of getting a score better than threshold S randomly 4) Use same formalism for sequence & structure [ e.g. P(score s>392) = 1% chance] P-values

33 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Statistics on Range of Similarities For 2107 pairs, only 2% Outliers (with subtle similarity) RMS Num. Aligned

34 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Scores from Structural Alignment Distributed Just Like Ones from Sequence Alignment (E.V.D.)

35 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu 3 Free Parm. fit to EVD involving: a, b, . These are the only difference betw. sequence and structure. Same Results for Sequence & Structure N, G, M also defined differently for sequence and structure. N = number of residues matched. G = total gap penalty. M(i,j) = similarity matrix (Blossum for seq. or M str (i,j), struc.) Structure Sequence

36 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Score Significance (P-value) derived from Extreme Value Distribution (just like BLAST, FASTA) F(s) = E.V.D of scores F(s) = exp(-Z(s) - exp(-Z(s))) Z(s) = As + ln(N) + B s = Score from random alignment N length of sequence matched A & B are fit parameters P(s>S) = CDF = integral[ F(s) ] P(s>S) = 1 - exp(-exp(-Z(s))) Given Score S (1%), P (s > S) is the chance that a given random score s is greater than the threshold i.e. P-value gives chance score would occur randomly Exactly like Sequence Matching Statistics (BLAST and FASTA)

37 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu RMS is a similarity Score Also, RMS doesn’t work instead of structural alignment (no EVD fit)  RMS penalizes worst fitting atoms, easily skewed S str RMS

38 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Structure alignment - Other methods What Structures Look Like? Structural Alignment by Iterated Dynamic Programming  RMS Superposition Scoring Structural Similarity Other Aspects of Structural Alignment  Distance Matrix based methods  Fold Library Relation of Sequence Similarity to Structural and Functional Similarity Protein Geometry Surface I (Calculation) Calculation of Volume Voronoi Volumes & Packing Standard Volumes & Radii Surfaces II (Relationship to Volumes) Other Applications of Volumes -- Motions, Docking

39 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Refine Method

40 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Significance Ignoring Crucial Features in Structural Similarity

41 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Other Methods of Structural Alignment RMS fitting used universally, but other alignment methods Comparison of Distance Matrices  Holm & Sander, DALI  Taylor & Orengo Structure Hashing Bryant, VAST Rice, Artymiuk Others Cohen (Soap) Sippl Godzik (Lattice)