Genomic Database - Ensembl Ka-Lok Ng Department of Bioinformatics Asia University.

Slides:



Advertisements
Similar presentations
© Wiley Publishing All Rights Reserved. Using Nucleotide Sequence Databases.
Advertisements

Human & Mouse Orthologous Gene Nomenclature (HUMOT) HUGO Gene Nomenclature Committee (HGNC) Matt Wright
Peter Tsai, Bioinformatics Institute.  University of California, Santa Cruz (UCSC)  A rapid and reliable display of any requested portion of genomes.
Visualization of genomic data Genome browsers. UCSC browser Ensembl browser Others ? Survey.
Tutorial 7 Genome browser. Free, open source, on-line broswer for genomes Contains ~100 genomes, from nematodes to human. Many tools that can be used.
Genome Browsers Carsten O. Daub Omics Science Center RIKEN, Japan May 2008.
Visualization of genomic data Genome browsers. How many have used a genome browser ? UCSC browser ? Ensembl browser ? Others ? survey.
UCSC Archaeal genome browser Advanced browsing September 19, 2006 David Bernick, Aaron Cozen and Todd Lowe September 19, 2006 David Bernick, Aaron Cozen.
Genome Related Biological Databases. Content DNA Sequence databases Protein databases Gene prediction Accession numbers NCBI website Ensembl website.
Biological Databases Chi-Cheng Lin, Ph.D. Associate Professor Department of Computer Science Winona State University – Rochester Center
Bootcamp: Data Resources1 Paul Bain Reference and Education Services Librarian Countway Library of Medicine Countway.
How to access genomic information using Ensembl August 2005.
Genome Browsing with the UCSC Genome Browser
Visualization of genomic data Genome browsers. UCSC browser Ensembl browser Others ? Survey.
Bioinformatics Genome anatomy Comparisons of some eukaryotic genomes Allignment of long genomic sequences Comparative genomics Oxford Grid Reconstruction.
Doug Brutlag 2011 Genome Databases Doug Brutlag Professor Emeritus of Biochemistry & Medicine Stanford University School of Medicine Genomics, Bioinformatics.
Login: BITseminar Pass: BITseminar2011 Login: BITseminar Pass: BITseminar2011.
Doug Brutlag Professor Emeritus Biochemistry & Medicine (by courtesy) Genome Databases Computational Molecular Biology Biochem 218 – BioMedical Informatics.
Doug Brutlag 2011 Next Generation Sequencing and Human Genome Databases Doug Brutlag Professor Emeritus of Biochemistry & Medicine Stanford University.
Genome Annotation and Databases Genomic DNA sequence Genomic annotation BIO520 BioinformaticsJim Lund Reading Ch 9, Ch10.
What is comparative genomics? Analyzing & comparing genetic material from different species to study evolution, gene function, and inherited disease Understand.
Tri-I Bioinformatics Workshop: Public data and tool repositories Alex Lash & Maureen Higgins Bioinformatics Core Memorial Sloan-Kettering Cancer Center.
Copyright OpenHelix. No use or reproduction without express written consent 2 Overview of Genome Browsers Materials prepared by Warren C. Lathe, Ph.D.
UCSC Genome Browser 1. The Progress 2 Database and Tool Explosion : 230 databases and tools 1996 : first annual compilation of databases and tools.
Bioinformatics. Sequence information Mapping information Phenotypic information Literature Prediction programs -Gene prediction -Promotor prediction -Functional.
COURSE OF BIOINFORMATICS Exam_31/01/2014 A.
Browsing the Genome Using Genome Browsers to Visualize and Mine Data.
Professional Development Course 1 – Molecular Medicine Genome Biology June 12, 2012 Ansuman Chattopadhyay, PhD Head, Molecular Biology Information Services.
Web Databases for Drosophila Introduction to FlyBase and Ensembl Database Wilson Leung6/06.
Alastair Kerr, Ph.D. WTCCB Bioinformatics Core An introduction to DNA and Protein Sequence Databases.
Accessing information on molecular sequences Bio 224 Dr. Tom Peavy Sept 1, 2010.
NCBI FieldGuide NCBI Molecular Biology Resources March 2007 Using Entrez.
Biological databases Exercises. Discovery of distinct sequence databases using ensembl.
P HYLO P AT : AN UPDATED VERSION OF THE PHYLOGENETIC PATTERN DATABASE CONTAINS GENE NEIGHBORHOOD Presenter: Reihaneh Rabbany Presented in Bioinformatics.
I NTRODUCTION TO DATABASES - P RACTICAL. Q UERY S EQUENCE >my weird new protein MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT.
Copyright OpenHelix. No use or reproduction without express written consent1.
Bioinformatics Workshops 1 & 2 1. use of public database/search sites - range of data and access methods - interpretation of search results - understanding.
What do we already know ? The rice disease resistance gene Pi-ta Genetically mapped to chromosome 12 Rybka et al. (1997). It has also been sequenced Bryan.
Tools in Bioinformatics Genome Browsers. Retrieving genomic information Previous lesson(s): annotation-based perspective of search/data Today: genomic-based.
Accessing and visualizing genomics data
Genomes at NCBI. Database and Tool Explosion : 230 databases and tools 1996 : first annual compilation of databases and tools lists 57 databases.
Welcome to the combined BLAST and Genome Browser Tutorial.
NCBI: something old, something new. What is NCBI? Create automated systems for knowledge about molecular biology, biochemistry, and genetics. Perform.
Visualization of genomic data Genome browsers. How many have used a genome browser ? UCSC browser ? Ensembl browser ? Others ? survey.
COURSE OF BIOINFORMATICS Exam_30/01/2014 A.
GeneConnect Use Cases and Design August 3, GeneConnect Database IDs are linked by Direct Annotation, Inferred Annotation, or Sequence Alignment.
BLAST: Basic Local Alignment Search Tool Robert (R.J.) Sperazza BLAST is a software used to analyze genetic information It can identify existing genes.
Introduction to Genes and Genomes with Ensembl
Genome Browsers.
From: RTCGD: retroviral tagged cancer gene database
Introduction to bioinformatics
Functional Annotation of the Horse Genome
GEP Annotation Workflow
Visualization of genomic data
Access to Sequence Data and Related Information
Visualization of genomic data
KEY CONCEPT Entire genomes are sequenced, studied, and compared.
Searching the NCBI Databases
KEY CONCEPT Entire genomes are sequenced, studied, and compared.
A User’s Guide to GO: Structural and Functional Annotation
Ensembl Genome Repository.
KEY CONCEPT Entire genomes are sequenced, studied, and compared.
Comparative Genomics.
Biological Databases BI420 – Introduction to Bioinformatics
with the Ensembl Genome Browser
TAMU Bovine QTL db and viewer
Gene Safari (Biological Databases)
KEY CONCEPT Entire genomes are sequenced, studied, and compared.
Problems from last section
KEY CONCEPT Entire genomes are sequenced, studied, and compared.
Presentation transcript:

Genomic Database - Ensembl Ka-Lok Ng Department of Bioinformatics Asia University

Ensembl Worked example The human protein single-stranded DNA binding protein 4, SSBP4. How can one find the mouse ortholog at Ensemble, without doing a BLAST search. Ans. From the Ensembl human genome browser, search for the SSBP4 gene.

It returns Ensembl Gene: ENSG (RefSeq NM_ ). Following the link to GeneView in the Orthologue Predication section are the results of sequence comparison between the human gene and genes from other organisms. The mouse gene ENSMUSG is a best reciprocal hit to the human. This mouse gene (growth differentiation factor 15) is a putative ortholog of the human SSBP4 corresponding to RefSeq. NM_ (see the Similarity Section).

NCBI NCBI Map Viewer NCBI Map Viewer Help NCBI Map Viewer Human Maps Help UCSC UCSC Genome Browser UCSC Genome Browser Archive UCSC Genome Browser Experimental Tracks UCSC Genome Browser Custom Tracks Genome Browser User’s Guide UCSC Genome Browser Mailing List Ensembl Project Ensembl Project Ensembl Preview Browser Other Genome Sequencing Projects Funded by NHGRI The Vertebrate Genome Annotation (VEGA) database