Www.bioalgorithms.infoAn Introduction to Bioinformatics Algorithms Sequence Alignment.

Slides:



Advertisements
Similar presentations
Proteins: Structure reflects function….. Fig. 5-UN1 Amino group Carboxyl group carbon.
Advertisements

DYNAMIC PROGRAMMING ALGORITHMS VINAY ABHISHEK MANCHIRAJU.
Alignment methods Introduction to global and local sequence alignment methods Global : Needleman-Wunch Local : Smith-Waterman Database Search BLAST FASTA.
Introduction to Bioinformatics Algorithms Divide & Conquer Algorithms.
Introduction to Bioinformatics Algorithms Divide & Conquer Algorithms.
Dynamic Programming: Sequence alignment
Measuring the degree of similarity: PAM and blosum Matrix
DNA sequences alignment measurement
Sequence Alignment.
Lecture 8 Alignment of pairs of sequence Local and global alignment
Introduction to Bioinformatics Algorithms Dynamic Programming: Edit Distance.
Sequence Alignment.
Introduction to Bioinformatics Algorithms Sequence Alignment.
Introduction to Bioinformatics Algorithms Block Alignment and the Four-Russians Speedup Presenter: Yung-Hsing Peng Date:
Scoring Matrices June 19, 2008 Learning objectives- Understand how scoring matrices are constructed. Workshop-Use different BLOSUM matrices in the Dotter.
Alignment methods and database searching April 14, 2005 Quiz#1 today Learning objectives- Finish Dotter Program analysis. Understand how to use the program.
Sequence Alignment Bioinformatics. Sequence Comparison Problem: Given two sequences S & T, are S and T similar? Need to establish some notion of similarity.
Scoring Matrices June 22, 2006 Learning objectives- Understand how scoring matrices are constructed. Workshop-Use different BLOSUM matrices in the Dotter.
Developing Pairwise Sequence Alignment Algorithms Dr. Nancy Warter-Perez June 23, 2004.
Introduction to bioinformatics
Sequence similarity.
Pairwise Alignment Global & local alignment Anders Gorm Pedersen Molecular Evolution Group Center for Biological Sequence Analysis.
Developing Pairwise Sequence Alignment Algorithms Dr. Nancy Warter-Perez May 20, 2003.
Developing Sequence Alignment Algorithms in C++ Dr. Nancy Warter-Perez May 21, 2002.
Bioinformatics Unit 1: Data Bases and Alignments Lecture 3: “Homology” Searches and Sequence Alignments (cont.) The Mechanics of Alignments.
Sequence Alignments Revisited
Developing Pairwise Sequence Alignment Algorithms Dr. Nancy Warter-Perez May 10, 2005.
Alignment methods II April 24, 2007 Learning objectives- 1) Understand how Global alignment program works using the longest common subsequence method.
Dynamic Programming I Definition of Dynamic Programming
Developing Pairwise Sequence Alignment Algorithms
Sequence Alignment.
Brandon Andrews.  Longest Common Subsequences  Global Sequence Alignment  Scoring Alignments  Local Sequence Alignment  Alignment with Gap Penalties.
Pairwise alignments Introduction Introduction Why do alignments? Why do alignments? Definitions Definitions Scoring alignments Scoring alignments Alignment.
An Introduction to Bioinformatics
CISC667, S07, Lec5, Liao CISC 667 Intro to Bioinformatics (Spring 2007) Pairwise sequence alignment Needleman-Wunsch (global alignment)
Evolution and Scoring Rules Example Score = 5 x (# matches) + (-4) x (# mismatches) + + (-7) x (total length of all gaps) Example Score = 5 x (# matches)
Pairwise Sequence Alignment (I) (Lecture for CS498-CXZ Algorithms in Bioinformatics) Sept. 22, 2005 ChengXiang Zhai Department of Computer Science University.
Introduction to Bioinformatics Algorithms Sequence Alignment.
Sequence Alignment Goal: line up two or more sequences An alignment of two amino acid sequences: …. Seq1: HKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITN-EYMKEDFLIKIETWHKP.
Alignment methods April 26, 2011 Return Quiz 1 today Return homework #4 today. Next homework due Tues, May 3 Learning objectives- Understand the Smith-Waterman.
Pairwise Sequence Alignment. The most important class of bioinformatics tools – pairwise alignment of DNA and protein seqs. alignment 1alignment 2 Seq.
Pairwise Sequence Alignment (II) (Lecture for CS498-CXZ Algorithms in Bioinformatics) Sept. 27, 2005 ChengXiang Zhai Department of Computer Science University.
Eric C. Rouchka, University of Louisville Sequence Database Searching Eric Rouchka, D.Sc. Bioinformatics Journal Club October.
Dynamic Programming: Sequence alignment CS 466 Saurabh Sinha.
An Introduction to Bioinformatics 2. Comparing biological sequences: sequence alignment.
. Sequence Alignment. Sequences Much of bioinformatics involves sequences u DNA sequences u RNA sequences u Protein sequences We can think of these sequences.
Pairwise alignment of DNA/protein sequences I519 Introduction to Bioinformatics, Fall 2012.
Sequence Analysis CSC 487/687 Introduction to computing for Bioinformatics.
Construction of Substitution Matrices
Sequence Alignment Csc 487/687 Computing for bioinformatics.
Function preserves sequences Christophe Roos - MediCel ltd Similarity is a tool in understanding the information in a sequence.
A Table-Driven, Full-Sensitivity Similarity Search Algorithm Gene Myers and Richard Durbin Presented by Wang, Jia-Nan and Huang, Yu- Feng.
In-Class Assignment #1: Research CD2
Space Efficient Alignment Algorithms and Affine Gap Penalties Dr. Nancy Warter-Perez.
Pairwise sequence alignment Lecture 02. Overview  Sequence comparison lies at the heart of bioinformatics analysis.  It is the first step towards structural.
Sequence Alignment.
Construction of Substitution matrices
Step 3: Tools Database Searching
Alignment methods April 17, 2007 Quiz 1—Question on databases Learning objectives- Understand difference between identity, similarity and homology. Understand.
Protein Sequence Alignment Multiple Sequence Alignment
Techniques for Protein Sequence Alignment and Database Searching G P S Raghava Scientist & Head Bioinformatics Centre, Institute of Microbial Technology,
Substitution Matrices and Alignment Statistics BMI/CS 776 Mark Craven February 2002.
Sequence Alignment.
Protein Sequence Alignments
Sequence Alignment Using Dynamic Programming
Intro to Alignment Algorithms: Global and Local
Sequence Alignment.
Pairwise Alignment Global & local alignment
Pairwise Sequence Alignment (II)
It is the presentation about the overview of DOT MATRIX and GAP PENALITY..
Presentation transcript:

Introduction to Bioinformatics Algorithms Sequence Alignment

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Outline Global Alignment Scoring Matrices Local Alignment Alignment with Affine Gap Penalties

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Outline - CHANGES Scoring Matrices - ADD an extra slidewith an example of 5x5 matrix. Local Alignment – ADD extra slide showing a naïve approach to local alignment

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info From LCS to Alignment: Change up the Scoring The Longest Common Subsequence (LCS) problem—the simplest form of sequence alignment – allows only insertions and deletions (no mismatches). In the LCS Problem, we scored 1 for matches and 0 for indels Consider penalizing indels and mismatches with negative scores Simplest scoring schema: +1 : match premium -μ : mismatch penalty -σ : indel penalty

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Simple Scoring When mismatches are penalized by –μ, indels are penalized by –σ, and matches are rewarded with +1, the resulting score is: #matches – μ(#mismatches) – σ (#indels)

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info The Global Alignment Problem Find the best alignment between two strings under a given scoring schema Input : Strings v and w and a scoring schema Output : Alignment of maximum score ↑→ = -б = 1 if match = -µ if mismatch s i-1,j-1 +1 if v i = w j s i,j = max s i-1,j-1 -µ if v i ≠ w j s i-1,j - σ s i,j-1 - σ  : mismatch penalty σ : indel penalty

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Scoring Matrices To generalize scoring, consider a (4+1) x(4+1) scoring matrix δ. In the case of an amino acid sequence alignment, the scoring matrix would be a (20+1)x(20+1) size. The addition of 1 is to include the score for comparison of a gap character “-”. This will simplify the algorithm as follows: s i-1,j-1 + δ (v i, w j ) s i,j = max s i-1,j + δ (v i, -) s i,j-1 + δ (-, w j )

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Measuring Similarity Measuring the extent of similarity between two sequences Based on percent sequence identity Based on conservation

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Percent Sequence Identity The extent to which two nucleotide or amino acid sequences are invariant A C C T G A G – A G A C G T G – G C A G 70% identical mismatch indel

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Making a Scoring Matrix Scoring matrices are created based on biological evidence. Alignments can be thought of as two sequences that differ due to mutations. Some of these mutations have little effect on the protein’s function, therefore some penalties, δ(v i, w j ), will be less harsh than others.

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Scoring Matrix: Example ARNK A5-2 R-7 3 N--70 K---6 Notice that although R and K are different amino acids, they have a positive score. Why? They are both positively charged amino acids  will not greatly change function of protein.

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Conservation Amino acid changes that tend to preserve the physico-chemical properties of the original residue Polar to polar aspartate  glutamate Nonpolar to nonpolar alanine  valine Similarly behaving residues leucine to isoleucine

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Scoring matrices Amino acid substitution matrices PAM BLOSUM DNA substitution matrices DNA is less conserved than protein sequences Less effective to compare coding regions at nucleotide level

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info PAM Point Accepted Mutation (Dayhoff et al.) 1 PAM = PAM 1 = 1% average change of all amino acid positions After 100 PAMs of evolution, not every residue will have changed some residues may have mutated several times some residues may have returned to their original state some residues may not changed at all

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info PAM X PAM x = PAM 1 x PAM 250 = PAM PAM 250 is a widely used scoring matrix: Ala Arg Asn Asp Cys Gln Glu Gly His Ile Leu Lys... A R N D C Q E G H I L K... Ala A Arg R Asn N Asp D Cys C Gln Q Trp W Tyr Y Val V

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info BLOSUM Blocks Substitution Matrix Scores derived from observations of the frequencies of substitutions in blocks of local alignments in related proteins Matrix name indicates evolutionary distance BLOSUM62 was created using sequences sharing no more than 62% identity

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info The Blosum50 Scoring Matrix

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Local vs. Global Alignment The Global Alignment Problem tries to find the longest path between vertices (0,0) and (n,m) in the edit graph. The Local Alignment Problem tries to find the longest path among paths between arbitrary vertices (i,j) and (i’, j’) in the edit graph.

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Local vs. Global Alignment The Global Alignment Problem tries to find the longest path between vertices (0,0) and (n,m) in the edit graph. The Local Alignment Problem tries to find the longest path among paths between arbitrary vertices (i,j) and (i’, j’) in the edit graph. In the edit graph with negatively-scored edges, Local Alignmet may score higher than Global Alignment

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Local vs. Global Alignment (cont ’ d) Global Alignment Local Alignment—better alignment to find conserved segment --T—-CC-C-AGT—-TATGT-CAGGGGACACG—A-GCATGCAGA-GAC | || | || | | | ||| || | | | | |||| | AATTGCCGCC-GTCGT-T-TTCAG----CA-GTTATG—T-CAGAT--C tccCAGTTATGTCAGgggacacgagcatgcagagac |||||||||||| aattgccgccgtcgttttcagCAGTTATGTCAGatc

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Local Alignment: Example Global alignment Local alignment Compute a “mini” Global Alignment to get Local

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Local Alignments: Why? Two genes in different species may be similar over short conserved regions and dissimilar over remaining regions. Example: Homeobox genes have a short region called the homeodomain that is highly conserved between species. A global alignment would not find the homeodomain because it would try to align the ENTIRE sequence

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info The Local Alignment Problem Goal: Find the best local alignment between two strings Input : Strings v, w and scoring matrix δ Output : Alignment of substrings of v and w whose alignment score is maximum among all possible alignment of all possible substrings

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info The Problem with this Problem Long run time O(n 4 ): - In the grid of size n x n there are ~n 2 vertices (i,j) that may serve as a source. - For each such vertex computing alignments from (i,j) to (i’,j’) takes O(n 2 ) time. This can be remedied by giving free rides

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Local Alignment: Example Global alignment Local alignment Compute a “mini” Global Alignment to get Local

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Local Alignment: Example

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Local Alignment: Example

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Local Alignment: Example

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Local Alignment: Example

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Local Alignment: Example

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Local Alignment: Running Time Long run time O(n 4 ): - In the grid of size n x n there are ~n 2 vertices (i,j) that may serve as a source. - For each such vertex computing alignments from (i,j) to (i’,j’) takes O(n 2 ) time. This can be remedied by giving free rides

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Local Alignment: Free Rides Vertex (0,0) The dashed edges represent the free rides from (0,0) to every other node. Yeah, a free ride!

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info The Local Alignment Recurrence The largest value of s i,j over the whole edit graph is the score of the best local alignment. The recurrence: 0 s i,j = max s i-1,j-1 + δ (v i, w j ) s i-1,j + δ (v i, -) s i,j-1 + δ (-, w j ) Notice there is only this change from the original recurrence of a Global Alignment

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info The Local Alignment Recurrence The largest value of s i,j over the whole edit graph is the score of the best local alignment. The recurrence: 0 s i,j = max s i-1,j-1 + δ (v i, w j ) s i-1,j + δ (v i, -) s i,j-1 + δ (-, w j ) Power of ZERO: there is only this change from the original recurrence of a Global Alignment - since there is only one “free ride” edge entering into every vertex

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Scoring Indels: Naive Approach A fixed penalty σ is given to every indel: -σ for 1 indel, -2σ for 2 consecutive indels -3σ for 3 consecutive indels, etc. Can be too severe penalty for a series of 100 consecutive indels

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Affine Gap Penalties In nature, a series of k indels often come as a single event rather than a series of k single nucleotide events: Normal scoring would give the same score for both alignments This is more likely. This is less likely.

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Accounting for Gaps Gaps- contiguous sequence of spaces in one of the rows Score for a gap of length x is: -(ρ + σx) where ρ >0 is the penalty for introducing a gap: gap opening penalty ρ will be large relative to σ: gap extension penalty because you do not want to add too much of a penalty for extending the gap.

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Affine Gap Penalties Gap penalties: -ρ-σ when there is 1 indel -ρ-2σ when there are 2 indels -ρ-3σ when there are 3 indels, etc. -ρ- x · σ (-gap opening - x gap extensions) Somehow reduced penalties (as compared to naïve scoring) are given to runs of horizontal and vertical edges

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Affine Gap Penalties and Edit Graph To reflect affine gap penalties we have to add “long” horizontal and vertical edges to the edit graph. Each such edge of length x should have weight -  - x * 

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Adding “ Affine Penalty ” Edges to the Edit Graph There are many such edges! Adding them to the graph increases the running time of the alignment algorithm by a factor of n (where n is the number of vertices) So the complexity increases from O(n 2 ) to O(n 3 )

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Manhattan in 3 Layers ρ ρ σ σ δ δ δ δ δ

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Affine Gap Penalties and 3 Layer Manhattan Grid The three recurrences for the scoring algorithm creates a 3-layered graph. The top level creates/extends gaps in the sequence w. The bottom level creates/extends gaps in sequence v. The middle level extends matches and mismatches.

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Switching between 3 Layers Levels: The main level is for diagonal edges The lower level is for horizontal edges The upper level is for vertical edges A jumping penalty is assigned to moving from the main level to either the upper level or the lower level (-  ) There is a gap extension penalty for each continuation on a level other than the main level (-  )

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info The 3-leveled Manhattan Grid

An Introduction to Bioinformatics Algorithmswww.bioalgorithms.info Affine Gap Penalty Recurrences s i,j = s i-1,j - σ max s i-1,j –(ρ+σ) s i,j = s i,j-1 - σ max s i,j-1 –(ρ+σ) s i,j = s i-1,j-1 + δ (v i, w j ) max s i,j s i,j Continue Gap in w (deletion) V - v 1 v v i-1 v i W w 1 w w j - - Start Gap in w (deletion): from middle Continue Gap in v (insertion) Start Gap in v (insertion):from middle Match or Mismatch End deletion: from top End insertion: from bottom