BioSci M160 / MolBio255 Structure-Function Relationships of Integral Membrane Proteins Homework Hartmut “Hudel” Luecke Biochemistry, Biophysics & Computer.

Slides:

Advertisements

Similar presentations

1 Amino acid and proteins Ghollam-Reza Moshtaghi-Kashanian Biochemistry Department Medical School Kerman University of Medical sciences.

Advertisements

Secondary structure prediction from amino acid sequence.

100% 90% 80% 70%.

11/9/99ICTAI-99, Chicago1 Protein Secondary Structure Prediction Using Data Mining Tool C5 Meiliu Lu †, Du Zhang †, Hongjun Xu †, Ken Tse-yau Lau ‡, and.

Organic Chem Review. MONOMERS Macromolecules are made up of smaller units called.

BIO 344 Lecture 2. Figure 10-11a Molecular Biology of the Cell (© Garland Science 2008)

Structural bioinformatics

1 September, 2004 Chapter 5 Macromolecular Structure.

Home assignment 1. 1.For what number of students n the probability that none of them have a birthday on the same day equals 0.2? 2. A card is drawn at.

Sequence analysis course Lecture 8 Sequence databank searching 1.

An Introduction to Bioinformatics Protein Structure Prediction.

Introduction to Structural Bioinformatics Dong Xu Computer Science Department 271C Life Sciences Center 1201 East Rollins Road University of Missouri-Columbia.

C E N T R F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U E Master Course Sequence Alignment Lecture 10 Database searching Issues (1)

Lecture 3 BIO 344. Hydrophobic amino acids in green and yellow.

Computational Biology, Part 10 Protein Structure Prediction and Display Robert F. Murphy Copyright  1996, 1999, All rights reserved.

Structures and Structure Descriptions Chapter 8 Protein Bioinformatics.

1. Primary Structure: Polypeptide chain Polypeptide chain Amino acid monomers Peptide linkages Figure 3.6 The Four Levels of Protein Structure.

微生物應用工業 Ch5. 微生物催化劑阮雪芬 Nov 19, 2002 NTUT

©CMBI 2006 Amino Acids “ When you understand the amino acids, you understand everything ”

Protein Structures.

Template-based Prediction of Protein 8-state Secondary Structures June 12 th 2013 Ashraf Yaseen and Yaohang Li DEPARTMENT OF COMPUTER SCIENCE OLD DOMINION.

Protein Tertiary Structure Prediction

Proteins (aka polypeptides)

Modeling Biomolecules Using the WWW. Major Classes of Biomolecules n Peptides (Proteins) n Carbohydrates n Nucleic Acids n Lipids.

1 Amide Bond Formation Amide bonds form upon reaction of carboxylic acids with ammonia, primary amines or secondary amines. When amide bonds form between.

Protein Structure and Function 1 , 2 , 3 , 4  Structure Viewing, interpreting structure Protein Characterization BIO520 BioinformaticsJim Lund.

Transmembrane proteins in the Protein Data Bank: identification and classification Gabor, E. Tusnady, Zsuzanna Dosztanyi and Istvan Simon Bioinformatics,

Levels of Protein Structure

70% 80% 90% 100%. BioSci M160 / MolBio255 Structure-Function Relationships of Integral Membrane Proteins Lecture 3 Hartmut “Hudel” Luecke Biochemistry,

© Wiley Publishing All Rights Reserved. Protein 3D Structures.

Amino acids and proteins … for AS Biology. Amino acids Proteins are macromolecules consisting of long unbranched chains of amino acids. All amino acids.

09/06/12 CSCE 769 Amino Acids, Polypeptides and Proteins Homayoun Valafar Department of Computer Science and Engineering, USC.

Protein Secondary Structure, Bioinformatics Tools, and Multiple Sequence Alignments Finding Similar Sequences Predicting Secondary Structures Predicting.

Mrs. Einstein Research in Molecular Biology. Importance of proteins for cell function: Proteins are the end product of the central dogma YOU are your.

7.5 Proteins Learning Target: Explain the significance of polar and nonpolar amino acids. Outline the difference between fibrous and globular proteins.

The α-helix forms within a continuous strech of the polypeptide chain 5.4 Å rise, 3.6 aa/turn  1.5 Å/aa N-term C-term prototypical  = -57  ψ = -47 

Biochemistry - as science; biomolecules; metabolic ways. Structure of proteins, methods of its determination.

Protein Structure Prediction ● Why ? ● Type of protein structure predictions – Sec Str. Pred – Homology Modelling – Fold Recognition – Ab Initio ● Secondary.

PROTEINS The final product of the DNA blueprint Hemoglobin.

Javad Jamshidi Fasa University of Medical Sciences, October 2015 The Biomembrane Structure & Function.

CH 2 OH OH Glucose. CH 2 OH OH CH 2 OH OH Glucose + glucose = OH Maltose + H 2 O H-O-H Formation of a disaccharide.

MEMBRANE STRUCTURE LECTURE 4 CHAPTER 10.

Protein Structure and Bioinformatics. Chapter 2 What is protein structure? What are proteins made of? What forces determines protein structure? What is.

Protein Structure  The structure of proteins can be described at 4 levels – primary, secondary, tertiary and quaternary.  Primary structure  The sequence.

Visually Demonstrating the Principles of Protein Folding Bill McClung, Jeff Schwehm, Greg Wolffe.

Protein backbone Biochemical view:

Marlou Snelleman 2012 Protein structure. Overview Sequence to structure Hydrogen bonds Helices Sheets Turns Hydrophobicity Helices Sheets Structure and.

Protein Tertiary Structure Prediction Structural Bioinformatics.

Protein motif /domain Structural unit Functional unit Signature of protein family How are they defined?

Structure and Function

Protein Structure Basics!

3.11 Proteins are essential to the structures and activities of life

Amino Acids and Proteins

DNA, RNA and Genes Science 10 – 2017/18 Mrs. Day.

. Nonpolar (hydrophobic) Nonpolar (hydrophobic) Amino Acid Side Chains

PROTEINS AHL Topic 7.5 IB Biology Miss Werba.

Effect of Fluoro-Amino Acids on Protein Secondary Structure Stability

Protein Structure Prediction

Protein structure and function Part II

Protein Structures.

SHAPE MATTERS!! Proteins & Amino Acids:

Life’s Beginnings on Earth according to science

Life’s Beginnings on Earth according to science

PC1 β-lactamase.

Life’s Beginnings on Earth according to science

1. It is made up of Monosaccharides

Volume 85, Issue 4, Pages (October 2003)

DNA, RNA and Genes Science 10 – 2017/18 Mrs. Day.

Life’s Beginnings on Earth according to science

Life’s Beginnings on Earth according to science

Presentation transcript:

BioSci M160 / MolBio255 Structure-Function Relationships of Integral Membrane Proteins Homework Hartmut “Hudel” Luecke Biochemistry, Biophysics & Computer Science

1) Use amino acid sequence on next slide to predict: transmembrane segments secondary structure (helix, strand, turn) hydrophilic & hydrophobic face of predicted helices (if any) using helical wheel analysis 2) Only once you have done 1) above, find & use the PDB (3D structure) file to evaluate accuracy of predictions (helix boundaries, hydrophobic faces etc.) Coot: (Windows) Homework (a.k.a. home education ;-)

Primary (amino acid) sequence of target protein in FASTA format: >MYSTERY|SEQUENCE DYKDDDAMGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFIT SLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVI ILMVWIVSGLTSFLPIQMHWYRATHQEAINCYAEETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLNIF EMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKL KPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKFC LKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRS SLKAYGNGYSSNGNTGEQSG Homework (a.k.a. home education ;-)

Helical Wheel