11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction1 11/11/05 Protein Structure Prediction & Modeling.

Slides:



Advertisements
Similar presentations
PROTEOMICS 3D Structure Prediction. Contents Protein 3D structure. –Basics –PDB –Prediction approaches Protein classification.
Advertisements

Protein Structure Prediction
Protein Threading Zhanggroup Overview Background protein structure protein folding and designability Protein threading Current limitations.
1 Protein Structure, Structure Classification and Prediction Bioinformatics X3 January 2005 P. Johansson, D. Madsen Dept.of Cell & Molecular Biology, Uppsala.
Protein Tertiary Structure Prediction
Structural bioinformatics
Structure Prediction. Tertiary protein structure: protein folding Three main approaches: [1] experimental determination (X-ray crystallography, NMR) [2]
CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Homology Modeling Anne Mølgaard, CBS, BioCentrum, DTU.
Protein Structure, Databases and Structural Alignment
Protein structure (Part 2 of 2).
Structure Prediction. Tertiary protein structure: protein folding Three main approaches: [1] experimental determination (X-ray crystallography, NMR) [2]
Thomas Blicher Center for Biological Sequence Analysis
The Protein Data Bank (PDB)
. Protein Structure Prediction [Based on Structural Bioinformatics, section VII]
1 Protein Structure Prediction Reporter: Chia-Chang Wang Date: April 1, 2005.
Protein Tertiary Structure. Primary: amino acid linear sequence. Secondary:  -helices, β-sheets and loops. Tertiary: the 3D shape of the fully folded.
Molecular modelling / structure prediction (A computational approach to protein structure) Today: Why bother about proteins/prediction Concepts of molecular.
Protein structure prediction May 30, 2002 Quiz#4 on June 4 Learning objectives-Understand difference between primary secondary and tertiary structure.
Protein Tertiary Structure Prediction Structural Bioinformatics.
CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Homology Modelling Thomas Blicher Center for Biological Sequence Analysis.
Computing for Bioinformatics Lecture 8: protein folding.
Protein Structure Analysis - I
Protein Tertiary Structure Prediction Structural Bioinformatics.
Protein Structures.
Protein Structural Prediction. Protein Structure is Hierarchical.
Bioinformatics for biomedicine Protein domains and 3D structure Lecture 4, Per Kraulis
Protein Structure Prediction Dr. G.P.S. Raghava Protein Sequence + Structure.
Protein Tertiary Structure Prediction
Construyendo modelos 3D de proteinas ‘fold recognition / threading’
Chapter 12 Protein Structure Basics. 20 naturally occurring amino acids Free amino group (-NH2) Free carboxyl group (-COOH) Both groups linked to a central.
Forces and Prediction of Protein Structure Ming-Jing Hwang ( 黃明經 ) Institute of Biomedical Sciences Academia Sinica
110/15/07BCB 444/544 F07 ISU Dobbs #23 - Protein Tertiary Structure Prediction BCB 444/544 Lecture 23  Protein Tertiary Structure Prediction #23_Oct15.
Macromolecular structure
Practical session 2b Introduction to 3D Modelling and threading 9:30am-10:00am 3D modeling and threading 10:00am-10:30am Analysis of mutations in MYH6.
10/10/07BCB 444/544 F07 ISU Dobbs #21 - Protein Secondary Structure Prediction1 BCB 444/544 Lecture 21 Protein Structure Visualization, Classification.
Genomics and Personalized Care in Health Systems Lecture 9 RNA and Protein Structure Leming Zhou, PhD School of Health and Rehabilitation Sciences Department.
CSCE555 Bioinformatics Lecture 18 Protein Tertiary Structure Prediction Meeting: MW 4:00PM-5:15PM SWGN2A21 Instructor: Dr. Jianjun Hu Course page:
Protein Structure Prediction. Historical Perspective Protein Folding: From the Levinthal Paradox to Structure Prediction, Barry Honig, 1999 A personal.
Lecture 10 – protein structure prediction. A protein sequence.
Representations of Molecular Structure: Bonds Only.
ProteinShop: A Tool for Protein Structure Prediction and Modeling Silvia Crivelli Computational Research Division Lawrence Berkeley National Laboratory.
CS 177 Proteins, part 2 (Computational modeling) Review of protein structures Computational Modeling Three-dimensional structural analysis in laboratory.
Lecture 12 CS5661 Structural Bioinformatics Motivation Concepts Structure Prediction Summary.
Protein Folding Programs By Asım OKUR CSE 549 November 14, 2002.
11/09/05 D Dobbs ISU - BCB 444/544X: Protein Structure Databases - cont.1 11/9/05 Protein Structure Databases (continued) Prediction & Modeling.
Protein Classification II CISC889: Bioinformatics Gang Situ 04/11/2002 Parts of this lecture borrowed from lecture given by Dr. Altman.
Part I : Introduction to Protein Structure A/P Shoba Ranganathan Kong Lesheng National University of Singapore.
Protein Structure & Modeling Biology 224 Instructor: Tom Peavy Nov 18 & 23, 2009
10/12/07BCB 444/544 F07 ISU Dobbs #22 - Secondary & Tertiary Structure Prediction BCB 444/544 Lecture 22  Secondary Structure Prediction  Tertiary Structure.
1 Protein Structure Prediction (Lecture for CS397-CXZ Algorithms in Bioinformatics) April 23, 2004 ChengXiang Zhai Department of Computer Science University.
Protein Tertiary Structure. Protein Data Bank (PDB) Contains all known 3D structural data of large biological molecules, mostly proteins and nucleic acids:
11/07/05 D Dobbs ISU - BCB 444/544X: Protein Structure: Classification, Databases, Visualization 1 11/7/05 Protein Structure: Classification, Databases,
Protein Modeling Protein Structure Prediction. 3D Protein Structure ALA CαCα LEU CαCαCαCαCαCαCαCα PRO VALVAL ARG …… ??? backbone sidechain.
Protein Structure Prediction: Homology Modeling & Threading/Fold Recognition D. Mohanty NII, New Delhi.
Modelling protein tertiary structure Ram Samudrala University of Washington.
Introduction to Protein Structure Prediction BMI/CS 576 Colin Dewey Fall 2008.
Protein Folding & Biospectroscopy Lecture 6 F14PFB David Robinson.
10/8/07BCB 444/544 F07 ISU Dobbs #20 - Protein Structure Basics & Classification1 BCB 444/544 Lecture 20 Protein Structure Basics, Visualization, Classification.
Protein Structure and Bioinformatics. Chapter 2 What is protein structure? What are proteins made of? What forces determines protein structure? What is.
Structural classification of Proteins SCOP Classification: consists of a database Family Evolutionarily related with a significant sequence identity Superfamily.
Modelling genome structure and function Ram Samudrala University of Washington.
Protein Tertiary Structure Prediction Structural Bioinformatics.
Modelling Genome Structure and Function Ram Samudrala University of Washington.
Forces and Prediction of Protein Structure Ming-Jing Hwang ( 黃明經 ) Institute of Biomedical Sciences Academia Sinica
Protein Structure Prediction. Protein Sequence Analysis Molecular properties (pH, mol. wt. isoelectric point, hydrophobicity) Secondary Structure Super-secondary.
Protein Structure Prediction and Protein Homology modeling
Protein Structure Prediction
Protein Structures.
CS 177 Proteins, part 2 (Computational modeling)
Protein structure prediction.
Presentation transcript:

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction1 11/11/05 Protein Structure Prediction & Modeling

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction2 Bioinformatics Seminars Nov 11 Fri 12:10 BCB Seminar in E164 Lago Building Supertrees Using Distances Steve Willson, Dept of Mathematics Next week - Baker Center/BCB Seminars:Baker Center/BCB Seminars: (seminar abstracts available at above link) Nov 14 Mon 1:10 PM Doug Brutlag, Stanford Discovering transcription factor binding sites Nov 15 Tues 1:10 PM Ilya Vakser, Univ Kansas Modeling protein-protein interactions both seminars will be in Howe Hall Auditorium

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction3 Protein Structure & Function: Analysis & Prediction Mon Protein structure: basics; classification,databases, visualization Wed Protein structure databases - cont. Thurs Lab Protein structure databases Visualization software Secondary structure prediction Fri Protein structure prediction Protein-nucleic acid interactions

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction4 Reading Assignment (for Mon-Fri) Mount Bioinformatics Chp 10 Protein classification & structure prediction pp Ck Errata:

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction5 BCB 544 Additional Reading Required: Gene Prediction: Burge & Karlin 1997 JMB 268:78 Prediction of complete gene structures in human genomic DNA Optional: Structure Prediction: Schueler-Furman…Baker 2005 Science 310:638 Progress in modeling of protein structures and interactions

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction6 Review last lecture: Protein Structure: Databases, Classification & Visualization

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction7 Protein sequence databases UniProt (SwissProt, PIR, EBI) NCBI Protein More on these later: protein function prediction

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction8 Protein sequence & structure: analysis Diamond STING Millennium - many useful structure analysis tools, including Protein Dossier SwissProt (UniProt) protein knowledgebase InterPRO sequence analysis tools

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction9 Protein structure databases PDB Protein Data Bank (RCSB) - THE protein structure database MMDB Molecular Modeling Database (NCBI Entrez) - has "added" value MSD Molecular Structure Database Especially good for interactions, binding sites

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction10 Protein structure classification SCOP = Structural Classification of Proteins Levels reflect both evolutionary and structural relationships CATH = Classification by Class, Architecture, Topology & Homology DALI/FSSP (recently moved to EBI & reorganized) fully automated structure alignments DALI serverhttp:// DALI Database (fold classification)

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction11 Protein structure visualization Molecular Visualization Freeware: MolviZ.Org Protein Explorer RASMOL (& many decendents: Protein Explorer,PyMol, MolMol, etc.) CHIME Cn3D Deep View = Swiss-PDB Viewer

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction12 Protein structure visualization Superb interactive structure visualization software by Jane & Dave Richardson, Duke University KINIMAGE Fantastic research tools for structure analysis & refinement

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction13 RCSB PDB - Beta site

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction14 MMDB

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction15 Cn3D

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction16 Cn3D : Displaying 2' Structures

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction17 Cn3D: Structural Alignments

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction18 SCOP - Structure Classification

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction19 6 main classes of protein structure 1)  Domains Bundles of helices connected by loops 2)  Domains Mainly antiparallel sheets, usually with 2 sheets forming sandwich 3)  Domains Mainly parallel sheets with intervening helices, also mixed sheets 4)  Domains Mainly segregated helices and sheets 5) Multidomain (  Containing domains from more than one class 6 ) Membrane & cell-surface proteins

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction20 CATH - Structure Classification

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction21 Structural Genomics ~ 30,000 "traditional" genes in human genome (not counting: ???) ~ 3,000 proteins in a typical cell > 2 million sequences in UniProt > 33,000 protein structures in the PDB  Experimental determination of protein structure lags far behind sequence determination! Goal: Determine structures of "all" protein folds in nature, using combination of experimental structure determination methods (X-ray crystallography, NMR, mass spectrometry) & structure prediction

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction22 Structural Genomics Projects TargetDB: database of structural genomics targets Protein Structure Prediction?

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction23 Protein Folding " Major unsolved problem in molecular biology" In cells:spontaneous assisted by enzymes assisted by chaperones In vitro: many proteins fold spontaneously & many do not!

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction24 Steps in Protein Folding 1- "Collapse"- driving force is burial of hydrophobic aa’s (fast - msecs) 2- Molten globule - helices & sheets form, but "loose" (slow - secs) 3- "Final" native folded state - compaction, some 2' structures rearranged Native state? - assumed to be lowest free energy - may be an ensemble of structures

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction25 Protein Dynamics Protein in native state is NOT static Function of many proteins depends on conformational changes, sometimes large, sometimes small Globular proteins are inherently "unstable" (NOT evolved for maximum stability) Energy difference between native and denatured state is very small (5-15 kcal/mol) (this is equivalent to 1 or 2 H-bonds!) Folding involves changes in both entropy & enthalpy

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction26 Protein Structure Prediction Structure is largely determined by sequence BUT: Similar sequences can assume different structures Dissimilar sequences can assume similar structures Many proteins are multi-functional Protein folding: determination of folding pathways prediction of tertiary structure  still largely unsolved problems

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction27 New today: Protein Structure Prediction Secondary structure (text focuses on this - I won't) Tertiary structure (let's do this instead!)

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction28 Deciphering the Protein Folding Code Protein Structure Prediction or "Protein Folding" Problem given the amino acid sequence of a protein, predict its 3-dimensional structure (fold) "Inverse Folding" Problem given a protein fold, identify every amino acid sequence that can adopt its 3-dimensional structure

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction29 Protein Structure Determination? High-resolution structure determination X-ray crystallography (<1A  ) Nuclear magnetic resonance (NMR) (~1-2.5A  ) Lower-resolution structure determination Cryo-EM (electron-microscropy) ~10-15A  Theoretical Models? Highly variable - now, some equiv to X-ray!

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction30 Tertiary Structure Prediction Fold or tertiary structure prediction problem can be formulated as a search for minimum energy conformation search space is defined by psi/phi angles of backbone and side-chain rotamers search space is enormous even for small proteins! number of local minima increases exponentially of the number of residues Computationally it is an exceedingly difficult problem!

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction31 Ab Initio Prediction 1.Develop energy function bond energy bond angle energy dihedral angle energy van der Waals energy electrostatic energy 2.Calculate structure by minimizing energy function (usually Molecular Dynamics or Monte Carlo methods)  Ab initio prediction - not practical in general Computationally? very expensive Accuracy? Usually poor for all but short peptides (but see Baker review!) Provides both folding pathway & folded structure

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction32 Comparative Modeling Provide folded structure only Two primary methods 1) Homology modeling 2) Threading (fold recognition) Note: both rely on availability of experimentally determined structures that are "homologous" or at least structurally very similar to target

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction33 Homology Modeling 1.Identify homologous protein sequences PSI-BLAST multiple sequence alignment (MSA) 2.Among those with available structures, choose closest sequence match for template 3.Build model by placing residues into corresponding positions of homologous structure models & refine by "tweaking"  Homology modeling - works "well" Computationally? not very expensive Accuracy? higher sequence identity  better model Requires >30% sequence identity

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction34 Threading - Fold Recognition Identify “best” fit between target sequence & template structure 1.Develop energy function 2.Develop template library 3.Align target sequence with each template & score 4.Determine best score (1D to 3D alignment) 5.Build refine structure as in homology modeling  Threading - works "sometimes" Computationally? Can be expensive or cheap, depends on energy function & whether "all atom" or "backbone only" threading Accuracy? in theory, should not depend on sequence identity (should depend on quality of template library & "luck") But, usually higher sequence identity  better model

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction35 1.Align target sequence with template structures (fold library) from the Protein Data Bank (PDB) 2.Calculate energy (score) to evaluate goodness of fit between target sequence & template structure 3.Rank models based on energy scores Target Sequence Structure Templates ALKKGF…HFDTSE Threading - a "local" example

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction36 Threading Goals & Issues Structure database - must be complete: no decent model if no good template in library! Sequence-structure alignment algorithm: Bad alignment  Bad score! Energy function (scoring scheme): must distinguish correct sequence-fold alignment from incorrect sequence-fold alignments must distinguish “correct” fold from close decoys Prediction reliability assessment - how determine whether predicted structure is correct (or even close?) Find “correct” sequence-structure alignment of a target sequence with its native-like fold in PDB

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction37 Threading – Structure database Build a template database (e.g., ASTRAL domain library derived from PDB) Supplement with additional decoys, e.g., generated using ab initio approach such as Rosetta (Baker)

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction38 Threading - Energy function Two main methods (and combinations of these) Structural profile (environmental) physico-chemical properties of aa’s Contact potential (statistical) based on contact statistics from PDB (Miyazawa & Jernigan - Jernigan now at ISU)

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction39 Protein Threading – typical energy function MTYKLILNGKTKGETTTEAVDAATAEKVFQYANDNGVDGEWTYTE How well does a specific residue fit structural environment? What is "probability" that two specific residues are in contact? Alignment gap penalty? Total energy: E_p + E_s + E_g Find a sequence-structure alignment that minimizing the energy function

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction40 A Rapid Threading Approach for Protein Structure Prediction Kai-Ming Ho, Physics Haibo Cao Yungok Ihm Zhong Gao James Morris Cai-zhuang Wang Drena Dobbs, GDCB Jae-Hyung Lee Michael Terribilini Jeff Sander

11/11/05 D Dobbs ISU - BCB 444/544X: Protein Structure Prediction41 Performance Evaluation? "Blind Test" CASP5 Competition (Critical Assessment of Protein Structure Prediction) Given: Amino acid sequence Goal: Predict 3-D structure ( before experimental results published)

Typical Results: well, actually, BEST Results: HO = #1 ranked CASP prediction for this target Target 174 PDB ID = 1MG7 Actual Structure Predicted Structure T174_1 T174_2

FR Fold Recognition (targets manually assessed by Nick Grishin) Rank Z-Score Ngood Npred NgNW NpNW Group-name Ginalski Skolnick Kolinski Baker BIOINFO.PL Shortle BAKER-ROBETTA Brooks Ho-Kai-Ming Jones-NewFold FR NgNW - number of good predictions without weighting for multiple models FR NpNW - number of total predictions without weighting for multiple models Overall Performance in CASP5 Contest (M. Levitt, Stanford)