Pairwise Sequence Alignment

Slides:



Advertisements
Similar presentations
Why Align Sequences? DNA sequences (4 letters in alphabet) – GTAAACTGGTACT… Amino acid (protein) sequences (20 letters) – SSHLDKLMNEFF… Align them so we.
Advertisements

Blast outputoutput. How to measure the similarity between two sequences Q: which one is a better match to the query ? Query: M A T W L Seq_A: M A T P.
Alignment methods Introduction to global and local sequence alignment methods Global : Needleman-Wunch Local : Smith-Waterman Database Search BLAST FASTA.
Sources Page & Holmes Vladimir Likic presentation: 20show.pdf
BLAST Sequence alignment, E-value & Extreme value distribution.
Previous Lecture: Probability
Measuring the degree of similarity: PAM and blosum Matrix
DNA sequences alignment measurement
Sequence Alignment.
Lecture 8 Alignment of pairs of sequence Local and global alignment
Introduction to Bioinformatics
C E N T R F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U E Alignments 1 Sequence Analysis.
Sequence Similarity Searching Class 4 March 2010.
Sequence Alignment Storing, retrieving and comparing DNA sequences in Databases. Comparing two or more sequences for similarities. Searching databases.
Heuristic alignment algorithms and cost matrices
We continue where we stopped last week: FASTA – BLAST
Alignment methods and database searching April 14, 2005 Quiz#1 today Learning objectives- Finish Dotter Program analysis. Understand how to use the program.
Introduction to bioinformatics
Sequence Comparison Intragenic - self to self. -find internal repeating units. Intergenic -compare two different sequences. Dotplot - visual alignment.
Sequence similarity.
Pairwise Alignment Global & local alignment Anders Gorm Pedersen Molecular Evolution Group Center for Biological Sequence Analysis.
Similar Sequence Similar Function Charles Yan Spring 2006.
Sequence Alignment III CIS 667 February 10, 2004.
Introduction to Bioinformatics Algorithms Sequence Alignment.
Bioinformatics Unit 1: Data Bases and Alignments Lecture 3: “Homology” Searches and Sequence Alignments (cont.) The Mechanics of Alignments.
Alignment III PAM Matrices. 2 PAM250 scoring matrix.
Sequence similarity. Motivation Same gene, or similar gene Suffix of A similar to prefix of B? Suffix of A similar to prefix of B..Z? Longest similar.
1 Lesson 3 Aligning sequences and searching databases.
Introduction to Bioinformatics From Pairwise to Multiple Alignment.
Alignment methods II April 24, 2007 Learning objectives- 1) Understand how Global alignment program works using the longest common subsequence method.
Sequence comparison: Score matrices Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas
Basics of Sequence Alignment and Weight Matrices and DOT Plot
TM Biological Sequence Comparison / Database Homology Searching Aoife McLysaght Summer Intern, Compaq Computer Corporation Ballybrit Business Park, Galway,
Alignment Statistics and Substitution Matrices BMI/CS 576 Colin Dewey Fall 2010.
Bioiformatics I Fall Dynamic programming algorithm: pairwise comparisons.
Pair-wise Sequence Alignment What happened to the sequences of similar genes? random mutation deletion, insertion Seq. 1: 515 EVIRMQDNNPFSFQSDVYSYG EVI.
An Introduction to Bioinformatics
. Sequence Alignment and Database Searching 2 Biological Motivation u Inference of Homology  Two genes are homologous if they share a common evolutionary.
CISC667, S07, Lec5, Liao CISC 667 Intro to Bioinformatics (Spring 2007) Pairwise sequence alignment Needleman-Wunsch (global alignment)
Evolution and Scoring Rules Example Score = 5 x (# matches) + (-4) x (# mismatches) + + (-7) x (total length of all gaps) Example Score = 5 x (# matches)
BLAST Workshop Maya Schushan June 2009.
Sequence Alignment Goal: line up two or more sequences An alignment of two amino acid sequences: …. Seq1: HKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITN-EYMKEDFLIKIETWHKP.
Amino Acid Scoring Matrices Jason Davis. Overview Protein synthesis/evolution Protein synthesis/evolution Computational sequence alignment Computational.
Pairwise Sequence Alignment. The most important class of bioinformatics tools – pairwise alignment of DNA and protein seqs. alignment 1alignment 2 Seq.
Pairwise alignment of DNA/protein sequences I519 Introduction to Bioinformatics, Fall 2012.
Previous Lecture: Descriptive Statistics ComplexNormalSkewedLong tails.
Comp. Genomics Recitation 3 The statistics of database searching.
Construction of Substitution Matrices
Sequence Alignment Csc 487/687 Computing for bioinformatics.
Function preserves sequences Christophe Roos - MediCel ltd Similarity is a tool in understanding the information in a sequence.
Basic terms:  Similarity - measurable quantity. Similarity- applied to proteins using concept of conservative substitutions Similarity- applied to proteins.
BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha.
BLAST Slides adapted & edited from a set by Cheryl A. Kerfeld (UC Berkeley/JGI) & Kathleen M. Scott (U South Florida) Kerfeld CA, Scott KM (2011) Using.
Pairwise Local Alignment and Database Search Csc 487/687 Computing for Bioinformatics.
Sequence Alignments with Indels Evolution produces insertions and deletions (indels) – In addition to substitutions Good example: MHHNALQRRTVWVNAY MHHALQRRTVWVNAY-
©CMBI 2005 Database Searching BLAST Database Searching Sequence Alignment Scoring Matrices Significance of an alignment BLAST, algorithm BLAST, parameters.
Pairwise sequence alignment Lecture 02. Overview  Sequence comparison lies at the heart of bioinformatics analysis.  It is the first step towards structural.
Sequence Alignment.
Construction of Substitution matrices
DNA, RNA and protein are an alien language
Sequence Alignment Abhishek Niroula Department of Experimental Medical Science Lund University
Step 3: Tools Database Searching
©CMBI 2005 Database Searching BLAST Database Searching Sequence Alignment Scoring Matrices Significance of an alignment BLAST, algorithm BLAST, parameters.
V diagonal lines give equivalent residues ILS TRIVHVNSILPSTN V I L S T R I V I L P E F S T Sequence A Sequence B Dot Plots, Path Matrices, Score Matrices.
Last lecture summary.
Techniques for Protein Sequence Alignment and Database Searching G P S Raghava Scientist & Head Bioinformatics Centre, Institute of Microbial Technology,
BIOINFORMATICS Ayesha M. Khan Spring Lec-6.
Substitution Matrices and Alignment Statistics BMI/CS 776 Mark Craven February 2002.
9/6/07BCB 444/544 F07 ISU Dobbs - Lab 3 - BLAST1 BCB 444/544 Lab 3 BLAST Scoring Matrices & Alignment Statistics Sept6.
Pairwise Sequence Alignment and Database Searching
Presentation transcript:

Pairwise Sequence Alignment Misha Kapushesky Slides: Stuart M. Brown, Fourie Joubert, NYU St. Petersburg Russia 2010

Protein Evolution “For many protein sequences, evolutionary history can be traced back 1-2 billion years” -William Pearson When we align sequences, we assume that they share a common ancestor They are then homologous Protein fold is much more conserved than protein sequence DNA sequences tend to be less informative than protein sequences Protein sequencce comparison and protein evolution ISMB 2000

Definition ATTGCGC  ATTGCGC ATTGCGC  AT-CCGC ATTGCGC  ATCCGC Homology: related by descent Homologous sequence positions ATTGCGC  ATTGCGC ATTGCGC  AT-CCGC ATTGCGC C  ATCCGC

Orthologous and paralogous Orthologous sequences differ because they are found in different species (a speciation event) Paralogous sequences differ due to a gene duplication event Sequences may be both orthologous and paralogous

Pairwise Alignment The alignment of two sequences (DNA or protein) is a relatively straightforward computational problem. There are lots of possible alignments. Two sequences can always be aligned. Sequence alignments have to be scored. Often there is more than one solution with the same score.

Methods of Alignment By hand - slide sequences on two lines of a word processor Dot plot with windows Rigorous mathematical approach Dynamic programming (slow, optimal) Heuristic methods (fast, approximate) BLAST and FASTA Word matching and hash tables0

Align by Hand GATCGCCTA_TTACGTCCTGGAC <-- --> AGGCATACGTA_GCCCTTTCGC You still need some kind of scoring system to find the best alignment

Percent Sequence Identity The extent to which two nucleotide or amino acid sequences are invariant A C C T G A G – A G A C G T G – G C A G mismatch indel 70% identical

Dotplot: A dotplot gives an overview of all possible alignments A     T     T     C    A     C    A     T     A     T A C A T T A C G T A C Sequence 2 Sequence 1

Dotplot: In a dotplot each diagonal corresponds to a possible (ungapped) alignment A     T     T     C    A     C    A     T     A     T A C A T T A C G T A C Sequence 2 Sequence 1 T A C A T T A C G T A C A T A C A C T T A One possible alignment:

Insertions / Deletions in a Dotplot Sequence 2 T A C G T A C T G T T C A T Sequence 1 T A C T G - T C A T | | | | | | | | | T A C T G T T C A T

Dotplot (Window = 130 / Stringency = 9) Hemoglobin -chain Hemoglobin -chain

Word Size Algorithm T A C G G T A T G Word Size = 3 A C A G T A T C C T A T  G A C A T A C G G T A T G T A C G G T A T G A C A G T A T C T A C G G T A T G A C A G T A T C T A C G G T A T G A C A G T A T C 

Window / Stringency Scoring Matrix Filtering Matrix: PAM250 Score = 11 PTHPLASKTQILPEDLASEDLTI  PTHPLAGERAIGLARLAEEDFGM Scoring Matrix Filtering Score = 11 Matrix: PAM250 Window = 12 Stringency = 9 PTHPLASKTQILPEDLASEDLTI  PTHPLAGERAIGLARLAEEDFGM Score = 7 PTHPLASKTQILPEDLASEDLTI PTHPLAGERAIGLARLAEEDFGM

Dotplot (Window = 18 / Stringency = 10) Hemoglobin -chain Hemoglobin -chain

Considerations The window/stringency method is more sensitive than the wordsize method (ambiguities are permitted). The smaller the window, the larger the weight of statistical (unspecific) matches. With large windows the sensitivity for short sequences is reduced. Insertions/deletions are not treated explicitly.

Heuristic algorithms (faster but approximate) Alignment methods Rigorous algorithms = Dynamic Programming Needleman-Wunsch (global) Smith-Waterman (local) Heuristic algorithms (faster but approximate) BLAST FASTA

The Rocks game N rocks, 2 piles, 2 players Player can Remove 1 rock from either pile Remove 1 rock from each pile Last to remove a rock wins Assume 10 rocks in each pile – winning strategy?

Dynamic Programming

Basic principles of dynamic programming - Creation of an alignment path matrix - Stepwise calculation of score values - Backtracking (evaluation of the optimal path)

Dynamic Programming Dynamic Programming is a very general programming technique. It is applicable when a large search space can be structured into a succession of stages, such that: the initial stage contains trivial solutions to sub-problems each partial solution in a later stage can be calculated by recurring a fixed number of partial solutions in an earlier stage the final stage contains the overall solution

Creation of an alignment path matrix Idea: Build up an optimal alignment using previous solutions for optimal alignments of smaller subsequences Construct matrix F indexed by i and j (one index for each sequence) F(i,j) is the score of the best alignment between the initial segment x1...i of x up to xi and the initial segment y1...j of y up to yj Build F(i,j) recursively beginning with F(0,0) = 0

Creation of an alignment path matrix If F(i-1,j-1), F(i-1,j) and F(i,j-1) are known we can calculate F(i,j) Three possibilities: xi and yj are aligned, F(i,j) = F(i-1,j-1) + s(xi ,yj) xi is aligned to a gap, F(i,j) = F(i-1,j) - d yj is aligned to a gap, F(i,j) = F(i,j-1) - d The best score up to (i,j) will be the largest of the three options

Backtracking H E A G A W G H E E 0 -8 -16 -24 -32 -40 -48 -56 -64 -72 -80 P -8 -2 -9 -17 -25 -33 -42 -49 -57 -65 -73 A -16 -10 -3 -4 -12 -20 -28 -36 -44 -52 -60 W -24 -18 -11 -6 -7 -15 -5 -13 -21 -29 -37 H -32 -14 -18 -13 -8 -9 -13 -7 -3 -11 -19 E -40 -22 -8 -16 -16 -9 -12 -15 -7 3 -5 A -48 -30 -16 -3 -11 -11 -12 -12 -15 -5 2 E -56 -38 -24 -11 -6 -12 -14 -15 -12 -9 1 -8 -16 -17 -25 -20 -5 -13 -3 3 -5 1 E H - E - A P G - A W G - H E - A Optimal global alignment:

Global vs. Local Alignments Global alignment algorithms start at the beginning of two sequences and add gaps to each until the end of one is reached. Local alignment algorithms finds the region (or regions) of highest similarity between two sequences and build the alignment outward from there.

Global Alignment Two closely related sequences: needle (Needleman & Wunsch) creates an end-to-end alignment.

Global Alignment Two sequences sharing several regions of local similarity: 1 AGGATTGGAATGCTCAGAAGCAGCTAAAGCGTGTATGCAGGATTGGAATTAAAGAGGAGGTAGACCG.... 67 |||||||||||||| | | | |||| || | | | || 1 AGGATTGGAATGCTAGGCTTGATTGCCTACCTGTAGCCACATCAGAAGCACTAAAGCGTCAGCGAGACCG 70

Global Alignment (Needleman-Wunsch) The the Needleman-Wunsch algorithm creates a global alignment over the length of both sequences (needle) Global algorithms are often not effective for highly diverged sequences - do not reflect the biological reality that two sequences may only share limited regions of conserved sequence. Sometimes two sequences may be derived from ancient recombination events where only a single functional domain is shared. Global methods are useful when you want to force two sequences to align over their entire length

Local Alignment (Smith-Waterman) Identify the most similar sub-region shared between two sequences Smith-Waterman EMBOSS: water

Parameters of Sequence Alignment Scoring Systems: Each symbol pairing is assigned a numerical value, based on a symbol comparison table. Gap Penalties: Opening: The cost to introduce a gap Extension: The cost to elongate a gap

DNA Scoring Systems -very simple Sequence 1 Sequence 2 Match: 1 actaccagttcatttgatacttctcaaa taccattaccgtgttaactgaaaggacttaaagact A G C T A 1 0 0 0 G 0 1 0 0 C 0 0 1 0 T 0 0 0 1 Match: 1 Mismatch: 0 Score = 5

Protein Scoring Systems Sequence 1 Sequence 2 PTHPLASKTQILPEDLASEDLTI PTHPLAGERAIGLARLAEEDFGM Scoring matrix C S T P A G N D . . C 9 S -1 4 T -1 1 5 P -3 -1 -1 7 A 0 1 0 -1 4 G -3 0 -2 -2 0 6 N -3 1 0 -2 -2 0 5 D -3 0 -1 -1 -2 -1 1 6 . C S T P A G N D . . C 9 S -1 4 T -1 1 5 P -3 -1 -1 7 A 0 1 0 -1 4 G -3 0 -2 -2 0 6 N -3 1 0 -2 -2 0 5 D -3 0 -1 -1 -2 -1 1 6 . T:G = -2 T:T = 5 Score = 48

Protein Scoring Systems Amino acids have different biochemical and physical properties that influence their relative replaceability in evolution. tiny P aliphatic C small S+S G G I A V S C N SH L D T hydrophobic M Y K E Q F W H R positive aromatic polar charged

Protein Scoring Systems Scoring matrices reflect: # of mutations to convert one to another chemical similarity – observed mutation frequencies – the probability of occurrence of each amino acid Widely used scoring matrices: PAM BLOSUM

PAM matrices Family of matrices PAM 80, PAM 120, PAM 250 The number with a PAM matrix represents the evolutionary distance between the sequences on which the matrix is based Greater numbers denote greater distances

PAM (Percent Accepted Mutations) matrices The numbers of replacements were used to compute a so-called PAM-1 matrix. The PAM-1 matrix reflects an average change of 1% of all amino acid positions. PAM matrices for larger evolutionary distances can be extrapolated from the PAM-1 matrix. PAM250 = 250 mutations per 100 residues. Greater numbers mean bigger evolutionary distance

PAM (Percent Accepted Mutations) matrices Derived from global alignments of protein families . Family members share at least 85% identity (Dayhoff et al., 1978). Construction of phylogenetic tree and ancestral sequences of each protein family Computation of number of replacements for each pair of amino acids

PAM 250 C W W -8 17 A R N D C Q E G H I L K M F P S T W Y V B Z

PAM - limitations Based on only one original dataset Examines proteins with few differences (85% identity) Based mainly on small globular proteins so the matrix is biased

BLOSUM matrices Different BLOSUMn matrices are calculated independently from BLOCKS (ungapped local alignments) BLOSUMn is based on a cluster of BLOCKS of sequences that share at least n percent identity BLOSUM62 represents closer sequences than BLOSUM45

BLOSUM (Blocks Substitution Matrix) Derived from alignments of domains of distantly related proteins (Henikoff & Henikoff,1992). Occurrences of each amino acid pair in each column of each block alignment is counted. The numbers derived from all blocks were used to compute the BLOSUM matrices. A C E A C E A - C = 4 A - E = 2 C - E = 2 A - A = 1 C - C = 1

The Blosum50 Scoring Matrix

BLOSUM (Blocks Substitution Matrix) Sequences within blocks are clustered according to their level of identity. Clusters are counted as a single sequence. Different BLOSUM matrices differ in the percentage of sequence identity used in clustering. The number in the matrix name (e.g. 62 in BLOSUM62) refers to the percentage of sequence identity used to build the matrix. Greater numbers mean smaller evolutionary distance.

More distant sequences PAM Vs. BLOSUM PAM100 = BLOSUM90 PAM120 = BLOSUM80 PAM160 = BLOSUM60 PAM200 = BLOSUM52 PAM250 = BLOSUM45 More distant sequences BLOSUM62 for general use BLOSUM80 for close relations BLOSUM45 for distant relations PAM120 for general use PAM60 for close relations PAM250 for distant relations

TIPS on choosing a scoring matrix Generally, BLOSUM matrices perform better than PAM matrices for local similarity searches (Henikoff & Henikoff, 1993). When comparing closely related proteins one should use lower PAM or higher BLOSUM matrices, for distantly related proteins higher PAM or lower BLOSUM matrices. For database searching the commonly used matrix is BLOSUM62.

Scoring Insertions and Deletions A T G T A A T G C A T A T G T G G A A T G A A T G T - - A A T G C A T A T G T G G A A T G A insertion / deletion The creation of a gap is penalized with a negative score value.

Why Gap Penalties? Gaps not permitted Score: 0 Match = 5 Mismatch = -4 1 GTGATAGACACAGACCGGTGGCATTGTGG 29 ||| | | ||| | || || | 1 GTGTCGGGAAGAGATAACTCCGATGGTTG 29 Match = 5 Mismatch = -4 Gaps allowed but not penalized Score: 88 1 GTG.ATAG.ACACAGA..CCGGT..GGCATTGTGG 29 ||| || | | | ||| || | | || || | 1 GTGTAT.GGA.AGAGATACC..TCCG..ATGGTTG 29

Why Gap Penalties? maximizes the number of matches and The optimal alignment of two similar sequences is usually that which maximizes the number of matches and minimizes the number of gaps. There is a tradeoff between these two - adding gaps reduces mismatches Permitting the insertion of arbitrarily many gaps can lead to high scoring alignments of non-homologous sequences. Penalizing gaps forces alignments to have relatively few gaps.

Gap Penalties How to balance gaps with mismatches? Gaps must get a steep penalty, or else you’ll end up with nonsense alignments. In real sequences, multi-base (or amino acid) gaps are quite common genetic insertion/deletion events “Affine” gap penalties give a big penalty for each new gap, but a much smaller “gap extension” penalty.

(g) = -3 - (3 -1) 0.1 = -3.2 Scoring Insertions and Deletions match = 1 mismatch = 0 Total Score: 4 A T G T T A T A C T A T G T G C G T A T A Total Score: 8 - 3.2 = 4.8 A T G T - - - T A T A C Gap parameters: d = 3 (gap opening) e = 0.1 (gap extension) g = 3 (gap lenght) (g) = -3 - (3 -1) 0.1 = -3.2 T A T G T G C G T A T A insertion / deletion

Modification of Gap Penalties Score Matrix: BLOSUM62 gap opening penalty = 3 gap extension penalty = 0.1 score = 6.3 1 ...VLSPADKFLTNV 12 |||| 1 VFTELSPAKTV.... 11 gap opening penalty = 0 gap extension penalty = 0.1 score = 11.3 1 V...LSPADKFLTNV 12 | |||| | | | 1 VFTELSPA.K..T.V 11

BLAST Algorithm Basic Local Alignment Search Tool Fast alignment technique(s) Similar to FASTA algorithms (not used much now) There are more accurate ones, but they’re slower BLAST makes a big use of lookup tables Idea: statistically significant alignments (hits) Will have regions of at least 3 letters same Or at least high scoring with respect to BLOSUM matrix Based on small local alignments more likely than CCNDHRKMTCSPNDNNRK TTNDHRMTACSPDNNNKH CCNDHRKMTCSPNDNNRK YTNHHMMTTYSLDNNNKK

BLAST Overview Given a query sequence Q Seven main stages Remove (filter) low complexity regions from Q Harvest k-tuples (triples) from Q Expand each triple into ~50 high scoring words Seed a set of possible alignments Generate high scoring pairs (HSPs) from the seeds Test significance of matches from HSPs Report the alignments found from the HSPs

BLAST Algorithm Part 1 Removing Low-complexity Segments Imagine matching HHHHHHHHKMAY and HHHHHHHHURHD The KMAY and URHD are the interesting parts But this pair score highly using BLOSUM It’s a good idea to remove the HHHHHHHs From the query sequence (low complexity) SEG program does this kind of thing Comes with most BLAST implementations Often doesn’t do much, and it can be turned off

Removing Low-complexity Segments Given a segment of length L With each amino acid occurring n1 n2 … n20 times Use the following measure for “compositional complexity”: To use this measure Slide a “window” of ~12 residues along Query Sequence Q Use a threshold to determine low complexity windows Use a minimise routine to replace the segment With an optimal minimised segment (or just an X)

BLAST Algorithm Part 2 Harvesting k-tuples Collect all the k-tuples of elements in Q k set to 3 for residues and 11 for DNA (can vary) Triples are called ‘words’. Call this set W S T S L S T S D K L M R STS TSL SLS LST

BLAST Algorithm Part 3 Finding High Scoring Triples Given a word w from W Find all other words w’ of same length (3), which: Appear in some database sequence Blosum(w,w’) > a threshold T Choose T to limit number to around 50 Call these the high scoring triples (words) for w Example: letting w=PQG, set T to be 13 Suppose that PQG, PEG, PSG, PQA are found in database Blosum(PQG,PQG) = 18, Blosum(PQG,PEG) = 15 Blosum(PQG,PSG) = 13, Blosum(PQG,PQA) = 12 Hence, PQG and PEG only are kept

Finding High Scoring Triples For each w in W, find all the high scoring words Organise these sets of words Remembering all the places where w was found in Q Each high scoring triple is going to be a seed In order to generate possible alignment(s) One seed can generate more than one alignment End of the first half of the algorithm Going to find alignments now

BLAST Algorithm Part 4 Seeding Possible Alignments Look at first triple V in query sequence Q Actually from Q (not from W - which has omissions) Retrieve the set of ~50 high scoring words Call this set HV Retrieve the list of places in Q where V occurs Call this set PV For every pair (word, pos) Where word is from HV and pos is from PV Find all the database sequences D Which have an exact match with word at position pos’ Store an alignment between Q and D With V matched at pos in Q and pos’ in D Repeat this for the second triple in Q, and so on

Seeding Possible Alignments Example Suppose Q = QQGPHUIQEGQQG Suppose V = QQG, HV = {QQG, QEG} Then PV = {1, 11} Suppose we are looking in the database at: D = PKLMMQQGKQEG Then the alignments seeded are: QQGPHUIQEGQQG word=QQG QQGPHUIQEGQQG word=QQG PKLMMQQGKQEG pos=1 PKLMMQQGKQEG pos=11 QQGPHUIQEGQQG word=QEG QQGPHUIQEGQQG word=QEG PKLMMQQGKQEG pos=1 PKLMMQQGKQEG pos=11

BLAST Algorithm Part 5 Generating High Scoring Pairs (HSPs) For each alignment A Where sequences Q and D are matched Original region matching was M Extend M to the left Until the Blosum score begins to decrease Extend M to the right Larger stretch of sequence now matches May have higher score than the original triple Call these high scoring pairs Throw away any alignments for which the score S of the extended region M is lower than some cutoff score

Extending Alignment Regions Example QQGPHUIQEGQQGKEEDPP Blosum(QQG,QQG) = 16 PKLMMQQGKQEGM QQGPHUIQEGQQGKEEDPP Blosum(QQGK,QQGK) = 21 QQGPHUIQEGQQGKEEDPP Blosum(QQGKE,QQGKQ) = 23 QQGPHUIQEGQQGKEEDPP Blosum(QQGKEE,QQGKQE) = 28 QQGPHUIQEGQQGKEEDPP Blosum(QQGKEED,QQGKQEG) = 27 So, the extension to the right stops here HSP (before left extension) is QQGKEE, scoring 28

BLAST Algorithm Part 6 Checking Statistical Significance Reason we extended alignment regions Give a more accurate picture of the probability of that BLOSUM score occurring by chance Question: is a HSP significant? Suppose we have a HSP such that It scores S for a region of length L in sequences Q & D Then the probability of two random sequences Q’ and D’ scoring S in a region of length L is calculated Where Q’ is same length as Q and D’ is same length as D This probability needs to be low for significance

BLAST Algorithm Part 7 Reporting the Alignments For each statistically significant HSP The alignment is reported If a sequence D has two HSPs with Query Q Two different alignments are reported Later versions of BLAST Try and unify the two alignments