Matlab Bioinformatics Toolkit Evaluation Kanishka Bhutani.

Slides:

Advertisements

Similar presentations

Secondary structure prediction from amino acid sequence.

Advertisements

Blast to Psi-Blast Blast makes use of Scoring Matrix derived from large number of proteins. What if you want to find homologs based upon a specific gene.

1 Introduction to Sequence Analysis Utah State University – Spring 2012 STAT 5570: Statistical Bioinformatics Notes 6.1.

Using a Mixture of Probabilistic Decision Trees for Direct Prediction of Protein Functions Paper by Umar Syed and Golan Yona department of CS, Cornell.

PROTEOMICS 3D Structure Prediction. Contents Protein 3D structure. –Basics –PDB –Prediction approaches Protein classification.

1 Profile Hidden Markov Models For Protein Structure Prediction Colin Cherry

Profiles for Sequences

Using PFAM database’s profile HMMs in MATLAB Bioinformatics Toolkit Presentation by: Athina Ropodi University of Athens- Information Technology in Medicine.

Intro to Bioinformatics Summary. What did we learn Pairwise alignment – Local and Global Alignments When? How ? Tools : for local blast2seq, for global.

Introduction to the GCG Wisconsin Package The Center for Bioinformatics UNC at Chapel Hill Jianping (JP) Jin Ph.D. Bioinformatics Scientist Phone: (919)

Chapter 9 Structure Prediction. Motivation Given a protein, can you predict molecular structure Want to avoid repeated x-ray crystallography, but want.

Sequence alignment SEQ1: VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKK VADALTNAVAHVDDPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHA SLDKFLASVSTVLTSKYR.

Profile-profile alignment using hidden Markov models Wing Wong.

Hidden Markov Models That Use Predicted Local Structure for Fold Recognition: Alphabets of Backbone Geometry R Karchin, M Cline, Y Mandel- Gutfreund, K.

Alignment methods and database searching April 14, 2005 Quiz#1 today Learning objectives- Finish Dotter Program analysis. Understand how to use the program.

Course Summary June 2, 2005 Programming Workshop Overview of course (presentation) Protein modeling, part 2 Instructor evaluations.

Lecture 9 Hidden Markov Models BioE 480 Sept 21, 2004.

Identifying functional residues of proteins from sequence info Using MSA (multiple sequence alignment) - search for remote homologs using HMMs or profiles.

Computational Biology, Part 10 Protein Structure Prediction and Display Robert F. Murphy Copyright  1996, 1999, All rights reserved.

The Protein Data Bank (PDB)

Algorithm Animation for Bioinformatics Algorithms.

Hidden Markov Models That Use Predicted Local Structure for Fold Recognition: Alphabets of Backbone Geometry R Karchin, M Cline, Y Mandel- Gutfreund, K.

Signaling Pathways and Summary June 30, 2005 Signaling lecture Course summary Tomorrow Next Week Friday, 7/8/05 Morning presentation of writing assignments.

Introduction to Bioinformatics - Tutorial no. 8 Protein Prediction: - PROSITE - Pfam - SCOP - TOPITS - genThreader.

Comparing protein structure and sequence similarities Sumi Singh Sp 2015.

Pairwise Alignment How do we tell whether two sequences are similar? BIO520 BioinformaticsJim Lund Assigned reading: Ch , Ch 5.1, get what you can.

Hidden Markov Models for Sequence Analysis 4

Proteins Secondary Structure Predictions Structural Bioinformatics.

Good solutions are advantageous Christophe Roos - MediCel ltd Similarity is a tool in understanding the information in a sequence.

Scoring Matrices Scoring matrices, PSSMs, and HMMs BIO520 BioinformaticsJim Lund Reading: Ch 6.1.

Sequence analysis: Macromolecular motif recognition Sylvia Nagl.

Multiple Alignment and Phylogenetic Trees Csc 487/687 Computing for Bioinformatics.

Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha.

Pairwise Sequence Alignment. The most important class of bioinformatics tools – pairwise alignment of DNA and protein seqs. alignment 1alignment 2 Seq.

Multiple Alignments Motifs/Profiles What is multiple alignment? HOW does one do this? WHY does one do this? What do we mean by a motif or profile? BIO520.

Sequence Based Analysis Tutorial NIH Proteomics Workshop Lai-Su Yeh, Ph.D. Protein Information Resource at Georgetown University Medical Center.

Computational prediction of protein-protein interactions Rong Liu

Construction of Substitution Matrices

Bioinformatics Multiple Alignment. Overview Introduction Multiple Alignments Global multiple alignment –Introduction –Scoring –Algorithms.

Protein Secondary Structure, Bioinformatics Tools, and Multiple Sequence Alignments Finding Similar Sequences Predicting Secondary Structures Predicting.

Protein Secondary Structure Prediction G P S Raghava.

Pairwise Sequence Analysis-III

Protein Sequence Analysis - Overview - NIH Proteomics Workshop 2007 Raja Mazumder Scientific Coordinator, PIR Research Assistant Professor, Department.

EMBOSS over a Grid 1. 1st EELA Grid School December 4th of 2006 Eduardo MURRIETA LEON Romualdo ZAYAS-LAGUNAS Pierre-Alain BRANGER Jérôme VERLEYEN Roberto.

Copyright OpenHelix. No use or reproduction without express written consent1.

BioPerl Ketan Mane SLIS, IU. BioPerl Perl and now BioPerl -- Why ??? Availability Advantages for Bioinformatics.

PROTEIN PATTERN DATABASES. PROTEIN SEQUENCES SUPERFAMILY FAMILY DOMAIN MOTIF SITE RESIDUE.

Sequence Based Analysis Tutorial March 26, 2004 NIH Proteomics Workshop Lai-Su L. Yeh, Ph.D. Protein Science Team Lead Protein Information Resource at.

Sequence Based Analysis Tutorial

Prediction of Protein Binding Sites in Protein Structures Using Hidden Markov Support Vector Machine.

Point Specific Alignment Methods PSI – BLAST & PHI – BLAST.

Contest Beta Test of Bioinformatics Toolbox in Matlab Hidden Markov Model for profile analysis of GPCR sequences ShannChing Chen.

Construction of Substitution matrices

Combining Evolutionary Information Extracted From Frequency Profiles With Sequence-based Kernels For Protein Remote Homology Detection Name: ZhuFangzhi.

Copyright OpenHelix. No use or reproduction without express written consent1.

Machine Learning Methods of Protein Secondary Structure Prediction Presented by Chao Wang.

V diagonal lines give equivalent residues ILS TRIVHVNSILPSTN V I L S T R I V I L P E F S T Sequence A Sequence B Dot Plots, Path Matrices, Score Matrices.

Proteins Structure Predictions Structural Bioinformatics.

DNA Sequences Analysis Hasan Alshahrani CS6800 Statistical Background : HMMs. What is DNA Sequence. How to get DNA Sequence. DNA Sequence formats. Analysis.

PROTEIN IDENTIFIER IAN ROBERTS JOSEPH INFANTI NICOLE FERRARO.

DNA SEQUENCE ALIGNMENT FOR PROTEIN SIMILARITY ANALYSIS CARL EBERLE, DANIEL MARTINEZ, MENGDI TAO.

Bioinformatics Computing 1 CMP 807 – Day 4 Kevin Galens.

Sequence: PFAM Used example: Database of protein domain families. It is based on manually curated alignments.

Basics of BLAST Basic BLAST Search - What is BLAST?

Pfam: multiple sequence alignments and HMM-profiles of protein domains

Predicting Active Site Residue Annotations in the Pfam Database

Sequence Based Analysis Tutorial

Sequence Based Analysis Tutorial

The future of protein secondary structure prediction accuracy

Protein structure prediction

Presentation transcript:

Matlab Bioinformatics Toolkit Evaluation Kanishka Bhutani

What I expected ??  Local/Global sequence alignments.  Multiple sequence alignments.  Choice of different scoring matrices (BLOSUM, PAM) for evaluation.  Build Hidden Markov Models.  Easily import sequences from databases (PFAM,PDB, Swissprot)

What I found ??  Most of the features.  “Bonus” = Microarray normalization tools. Microarray normalization tools. Microarray Visualization tools including box plots, heat maps. Microarray Visualization tools including box plots, heat maps.

Any surprises ?  No “Multiple sequence alignments”  Avg./Std Dev. of hydrophobicity, solvent accessibility : Command ?  “Proteinplot”- GUI for protein structure analysis.  Import your file to view, select parameters and display stats.

What all I tried?  Local alignment, Global alignment.  For short sequences: swalign(‘seq1’,’seq2’) swalign(‘seq1’,’seq2’) nwalign(‘seq1’,’seq2’) nwalign(‘seq1’,’seq2’) seq1,seq2: AA or NT sequences.  For ‘imported’ long sequences: Convert seq into a vector of integer values Commands: nt2int, aa2int

Pairwise Sequence alignment  S = getgenbank(‘NM_00001’)  M= getgenbank(‘NM_00002’)  Output : Header and a sequence.  K=nt2int(S.Sequence) B=nt2int(M.Sequence) B=nt2int(M.Sequence) [sc,align] = nwalign [K,B] Alignment Score Aligned seq.

Getting sequences : V Easy !  ‘getgenbank’: Retrieve sequence information from Genbank database.  ‘getembl’: Retrieve seq. information from EMBL database.  ‘getpept’: Retrieve seq information from Genpept database.  ‘gethmmprof’: Get HMM from the PFAM database.

Experiment  hmmodel = gethmmprof(‘PF00001’)

Visualization of model Showhmmprof (hmmodel,’scale’,’logodds’)

Get GPCR seq’s  S = getgenbank (‘NM_024531’)  disp (S.Sequence)

Alignment of the seq’s  var = gethmmalignment (‘PF00001,’type’,’seed’)  disp [char(var.Header) char (var.Sequence)]

For GPCR Family C  Similarly for diff families.  Multiple aligned sequences retrieved.

GUI proteinplot  User friendly.  Avg./ Std. dev values for: Hydrophobicity. Hydrophobicity. Secondary structure propensity (Alpha helices or beta strands) Secondary structure propensity (Alpha helices or beta strands) Accessibility (accessible and buried residues) Accessibility (accessible and buried residues)

Mglur1 plot (Proteinplot)

Mglur1 results Parameter Average (%) Std. Dev.(%) Accessible residues Buried residues Alpha helix Beta sheet Hydrophobicity

Test a seq. with HMM  Retrieve mglur1 from Genbank mgr = getgenbank (‘NM_012407’) mgr = getgenbank (‘NM_012407’) glusequence = mgr.sequence glusequence = mgr.sequence  Test it with the HMM model class A [a.sglu] = hmmprofalign (model A, glusequence,’showscore’,true) [a.sglu] = hmmprofalign (model A, glusequence,’showscore’,true)  Score =  Seq =

Log odd score plot for best path

Difficulties & questions  No multiple sequence alignment.  Demos: Not very helpful.  Difficult to view the sequences as no “disp” command found.  Bugs: Storing huge sequences (GPCR A) in a file, parsing error. Storing huge sequences (GPCR A) in a file, parsing error. HMMprofdemo command abruptly stops and gives errors. HMMprofdemo command abruptly stops and gives errors.  Proteinplot (GUI) hangs the machine often.  Verify the sequences using the HMM models ??  Regular expression matches and highlighting those positions??

Suggestions of experiment  Given an unknown sample dataset of proteins, known dataset of proteins (known structural information).  Utilize the BLMT to extract ‘over expressed’ 4 Grams in a protein sequence or a group of protein sequences from the known set.  Use “search for regular expression” function in the Matlab toolkit to look for those ‘4 Grams’ in unknown proteins and hence predict their structure.