Tropicihabitans flavus gen. nov., sp. nov., a new member of the family Cellulomonadaceae Moriyuki Hamada, Chiyo Shibata, Arif Nurkanto, Shanti Ratnakomala,

Slides:

Advertisements

Similar presentations

Supplementary Fig. 1 Transmission electron micrographs of strains a CCR04 and b CCR80 grown on nutrient agar for 24 h. a b.

Advertisements

Warm Up Section 4.3 Draw and label each of the following in a circle with center P. (1). Radius: (2). Diameter: (3). Chord that is NOT a diameter: (4).

Supplementary Fig. S1. 16S RNA Neighbor-joining (NJ) tree of Brevibacterium metallicus sp. nov. NM2E3 T (in bold) and related species of genus Brevibacterium.

MB-PO13 T S. graminisoli NBRC T S. shenzhenensis DSM T Fig. S1. Substrate mycelium appearance of strain MB-PO13 T and related Streptomyces.

Supplemental material 1.Spraying with ethephon produces an ethylene physiological response. One-month-old seedlings were sprayed with different concentrations.

Supplemental Fig. S1. Orange- and yellow-flowered cultivars of calendula used in this study. Alice OrangeOrange StarPompom OrangeOrange Gem Alice YellowGold.

Supplementary Information Formate-H 2 -lyase, a Driver of Hydrogenotrophic Processes in the Root-zone of a Methane-emitting Fen Sindy Hunger, Oliver Schmidt,

Miscanthus and Reed, a large perennial wetland grass, are receiving considerable attention as potential bio-energy crops because of their ability to produce.

Supplementary Fig. 1 ClustalW (2.1) multiple sequence alignment and comparison of deduced partial protein sequences of SOS1 in root tissues of wheat genotypes.

Trichoderma eijii sp. nov. Trichoderma pseudolacteum sp. nov. 10 changes Nectria cinnabarina CBS (AF163025) H. psychrophila Hy 8 (EU330957) H. microcitrina.

(BPL-1, BD, BP, BC, BSP1, BSP4, Bsa-2)

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

From: Phylogenetic Analysis of the ING Family of PHD Finger Proteins

A b b a a a a a a c a a b a a b a,b a,c a B c b,c a a,c a,c c a b,c b

Fig. 1. Locations of shelf station C3a and oceanic station S412.

Fig.1. Dendrogram depicting NJ/ML/MP trees constructed using –MEGA 6

Molecular characterization of dengue virus 1 from autochthonous dengue fever cases in Croatia I.C. Kurolt, L. Betica-Radić, O. Daković-Rode, L. Franco,

Supplementary Fig. 2- Maximum likelihood phylogenetic trees drawn for the (a) VP1 gene of R2 strains, (b) VP2 gene of C2 strains, (c) VP3 gene of M2 strains,

gt 3 gt 1 gt 2 gt 4 swHEV sw-NL Netherlands (EU526647)

Fig. S1 Electron micrographs showing the general morphology and binary fission of negatively stained cells of strain 3-0-1T. Cells were grown on R2A agar.

The Derivative as a Function

A.K. Reddy, P. Garg, I. Kaur Clinical Microbiology and Infection

The bar indicates divergence.

E. Descloux, C. La Fuentez, Y. Roca, X. De Lamballerie

S. Manna, B. D. Ortika, E. M. Dunne, K. E. Holt, M. Kama, F. M

Lateral Transfer of an EF-1α Gene

M.V. Assous, A. Wilamowski Clinical Microbiology and Infection

Zika virus genome from the Americas

Development of 16S rRNA-based probes for the identification of Gram-positive anaerobic cocci isolated from human clinical specimens A.C.M. Wildeboer-Veloo,

Investigation of human parvovirus B19 occurrence and genetic variability in different leukaemia entities A.C. da Costa, I. Bendit, A.C.S. de Oliveira,

S. Manna, B. D. Ortika, E. M. Dunne, K. E. Holt, M. Kama, F. M

3-I 3 3-II Farm S1-25f swine (AY858911) Mexico

Detection of Anaplasma phagocytophilum in wild boar in Slovenia

West Nile virus outbreak in Israel in 2015: phylogenetic and geographic characterization in humans and mosquitoes Y. Lustig, Z. Kaufman, B. Mannasse,

Evaluation of antimicrobial properties and their substances against pathogenic bacteria in-vitro by probiotic Lactobacilli strains isolated from commercial.

F. Aujoulat, H. Marchandin, I. Zorgniotti, A. Masnou, E. Jumas-Bilak

Molecular epidemiology of clinical Acinetobacter baumannii and Acinetobacter genomic species 13TU isolates using a multilocus sequencing typing scheme

K. Strasek Smrdel, N. Tozon, D. Duh, M. Petrovec, T. Avsic Zupanc

F. Magurano Clinical Microbiology and Infection

Sequence-based identification, genotyping and EUCAST antifungal susceptibilities of Trichosporon clinical isolates from Greece M. Arabatzis, P. Abel,

A novel phlebovirus in Albanian sandflies

Ehrlichia canis phylogenetic analysis of the Borgo (Corsica) strain

C. O'Driscoll, J. Konjek, B. Heym, M. M. Fitzgibbon, B. J. Plant, M

A. Papa, K. Xanthopoulou, S. Gewehr, S. Mourelatos

Identification and pathogenicity analysis of a novel non-tuberculous mycobacterium clinical isolate with nine-antibiotic resistance Z.-Y. Zhang, Z.-Q.

Fig. 2 Identification of the candidate AvrSr35 gene.

Detection of Wolbachia genes in a patient with non-Hodgkin's lymphoma

Association of blaDHA-1 and qnrB genes carried by broad-host-range plasmids among isolates of Enterobacteriaceae at a Spanish hospital C. Mata, E. Miró,

Hepatitis B virus in Buenos Aires, Argentina: genotypes, virological characteristics and clinical outcomes S.C. Pezzano, C. Torres, H.A. Fainboim, M.B.

Development of a real-time PCR assay for the specific detection and identification of Streptococcus pseudopneumoniae using the recA gene V. Sistek, M.

Molecular characterization of dengue virus 1 from autochthonous dengue fever cases in Croatia I.C. Kurolt, L. Betica-Radić, O. Daković-Rode, L. Franco,

Outbreak of hand, foot and mouth disease/herpangina associated with coxsackievirus A6 and A10 infections in 2010, France: a large citywide, prospective.

MW polyomavirus and STL polyomavirus present in tonsillar tissues from children with chronic tonsillar disease J. Peng, K. Li, C. Zhang, Q. Jin Clinical.

Complete nucleotide sequence analysis of the VP1 genomic region of Echoviruses 6 isolated from sewage in Greece revealed 98% similarity with Echoviruses.

HBV subgenotype misclassification expands quasi-subgenotype A3

Emergence of Crimean–Congo haemorrhagic fever in Greece

Genetic diversity of Legionella pneumophila inferred from rpoB and dotA sequences K.S. Ko, H. Miyamoto, H.K. Lee, M.-Y. Park, K. Fukuda, B.J. Park, Y.-H.

Molecular epidemiology and genetic diversity of human astrovirus in South Korea from 2002 to 2007 A.Y. Jeong, H.S. Jeong, M.Y. Jo, S.Y. Jung, M.S. Lee,

K. S. Ko, T. Kuwahara, L. Haehwa, Y. -J. Yoon, B. -J. Kim, K. -H

T. A. Nguyen, L. P. Hoang, L. D. Pham, K. T. Hoang, S. Okitsu, M

Sandfly fever virus outbreak in Cyprus

Unrooted neighbour-joining phylogenetic tree based on the 5′UTR (5′ untranslated region) sequence among pestiviruses. Unrooted neighbour-joining phylogenetic.

Phylogenetic comparison among selected Pasteurella multocida and Haemophilus influenzae species with completed genome sequences. Phylogenetic comparison.

Characterization of SsPV1/WF-1 isolated from hypovirulent strain WF-1.

Distance tree of ITS2 rRNA gene sequences of 54 strains belonging to species known as black-grain mycetoma agents. Distance tree of ITS2 rRNA gene sequences.

Phylogenetic tree based on predominant 16S rRNA gene sequences obtained by C4–V8 Sutterella PCR from AUT-GI patients, Sutterella species isolates, and.

Figure 1. Unrooted phylogenetic trees for UL73 and UL74 based on amino acid sequences derived from 243 genome ... Figure 1. Unrooted phylogenetic trees.

Volume 3, Issue 6, Pages (November 2010)

Relationship of partial rpoB gene sequences inferred by the neighbor-joining method for Canadian study strains of C. pyruviciproducens. Relationship of.

Tree depicting the phylogenetic relationships of all strains included in this study. Tree depicting the phylogenetic relationships of all strains included.

Presentation transcript:

Tropicihabitans flavus gen. nov., sp. nov., a new member of the family Cellulomonadaceae Moriyuki Hamada, Chiyo Shibata, Arif Nurkanto, Shanti Ratnakomala, Puspita Lisdiyanti, Tomohiko Tamura and Ken-ichiro Suzuki Antonie van Leeuwenhoek Corresponding author: Moriyuki Hamada Biological Resource Center, National Institute of Technology and Evaluation (NBRC)

Myceligenerans xiligouense XLG9A10.2 T (AY354285) Promicromonospora citrea DSM T (X83808) Xylanibacterium ulmi XIL08 T (AY273185) Xylanimicrobium pachnodae VPCX2 T (AF105422) Xylanimonas cellulosilytica XIL07 T (AF403541) Isoptericola chiayiensis 06182M-1 T (FJ469988) Isoptericola halotolerans YIM T (AY789835) Isoptericola jiangsuensis CLG T (EU852101) Isoptericola dokdonensis DS-3 T (DQ387860) Isoptericola variabilis NBRC T (AB489221) Isoptericola nanjingensis H17 T (HQ222356) Isoptericola hypogeus HKI0342 T (AJ854061) Cellulosimicrobium cellulans DSM T (X79455) Luteimicrobium xylanilyticum W-15 T (JQ039191) Luteimicrobium album RI148-Li105 T (AB646194) Luteimicrobium subarcticum R19-04 T (AB489904) Demequina aestuarii NBRC T (AB639015) Lysinimicrobium mangrovi HI08-69 T (AB639012) Actinotalea fermentans NBRC T (AB639014) Cellulomonas bogoriensis 69B4 T (X92152) Cellulomonas carbonis T26 T (HQ702749) Cellulomonas hominis DMMZ CE40 T (X82598) Cellulomonas denverensis W6929 T (AY501362) Cellulomonas gelida DSM T (X83800) Cellulomonas uda DSM T (X83801) Cellulomonas iranensis O T (AF064702) Cellulomonas composti TR7-06 T (AB166887) Cellulomonas flavigena DSM T (X83799) Cellulomonas marina FXJ8.089 T (JF346422) Cellulomonas oligotrophica Kc5 T (AB602499) Cellulomonas fimi DSM T (X79460) Cellulomonas biazotea DSM T (X83802) Cellulomonas chitinilytica X.bu-b T (AB268586) Cellulomonas cellasea DSM T (X83804) Cellulomonas soli Kc1 T (AB602498) Cellulomonas humilata NCTC T (X82449) Cellulomonas xylanilytica XIL11 T (AY303668) Cellulomonas terrae DB5 T (AY884570) Tropicihabitans flavus PS T (AB971840) Tropicihabitans flavus RS-7-1 (AB971841) Oerskovia paurometabola DSM T (AJ314851) Oerskovia jenensis DSM T (AJ314848) Oerskovia turbata DSM T (X83806) Oerskovia enterophila DSM T (X83807) Sediminihabitans luteus H97-3 T (AB695376) Sanguibacter keddieii ST-74 T (X79450) Sanguibacter antarcticus KOPRI21702 T (EF211071) Sanguibacter soli DCY22 T (EF547937) Paraoerskovia sediminicola H25-14 T (AB695378) Paraoerskovia marina NBRC T (AB695379) Brevibacterium linens DSM T (X77451) Supplementary Fig. S1. Maximum-likelihood tree derived from the 16S rRNA gene sequences of strains PS T and RS-7-1 and their taxonomic neighbours. The 16S rRNA gene sequence of Brevibacterium linens DSM T (X77451) was used as the outgroup. Bootstrap values (>70 %) based on 1000 replicates are shown at branch nodes.

Myceligenerans xiligouense XLG9A10.2 T (AY354285) Promicromonospora citrea DSM T (X83808) Xylanibacterium ulmi XIL08 T (AY273185) Xylanimicrobium pachnodae VPCX2 T (AF105422) Xylanimonas cellulosilytica XIL07 T (AF403541) Isoptericola chiayiensis 06182M-1 T (FJ469988) Isoptericola halotolerans YIM T (AY789835) Isoptericola jiangsuensis CLG T (EU852101) Isoptericola dokdonensis DS-3 T (DQ387860) Isoptericola variabilis NBRC T (AB489221) Isoptericola nanjingensis H17 T (HQ222356) Isoptericola hypogeus HKI0342 T (AJ854061) Cellulosimicrobium cellulans DSM T (X79455) Luteimicrobium xylanilyticum W-15 T (JQ039191) Luteimicrobium album RI148-Li105 T (AB646194) Luteimicrobium subarcticum R19-04 T (AB489904) Demequina aestuarii NBRC T (AB639015) Lysinimicrobium mangrovi HI08-69 T (AB639012) Actinotalea fermentans NBRC T (AB639014) Cellulomonas bogoriensis 69B4 T (X92152) Cellulomonas carbonis T26 T (HQ702749) Cellulomonas hominis DMMZ CE40 T (X82598) Cellulomonas denverensis W6929 T (AY501362) Cellulomonas gelida DSM T (X83800) Cellulomonas uda DSM T (X83801) Cellulomonas iranensis O T (AF064702) Cellulomonas composti TR7-06 T (AB166887) Cellulomonas flavigena DSM T (X83799) Cellulomonas marina FXJ8.089 T (JF346422) Cellulomonas oligotrophica Kc5 T (AB602499) Cellulomonas fimi DSM T (X79460) Cellulomonas biazotea DSM T (X83802) Cellulomonas chitinilytica X.bu-b T (AB268586) Cellulomonas cellasea DSM T (X83804) Cellulomonas soli Kc1 T (AB602498) Cellulomonas humilata NCTC T (X82449) Cellulomonas xylanilytica XIL11 T (AY303668) Cellulomonas terrae DB5 T (AY884570) Tropicihabitans flavus PS T (AB971840) Tropicihabitans flavus RS-7-1 (AB971841) Oerskovia paurometabola DSM T (AJ314851) Oerskovia jenensis DSM T (AJ314848) Oerskovia turbata DSM T (X83806) Oerskovia enterophila DSM T (X83807) Sediminihabitans luteus H97-3 T (AB695376) Sanguibacter keddieii ST-74 T (X79450) Sanguibacter antarcticus KOPRI21702 T (EF211071) Sanguibacter soli DCY22 T (EF547937) Paraoerskovia sediminicola H25-14 T (AB695378) Paraoerskovia marina NBRC T (AB695379) Brevibacterium linens DSM T (X77451) Supplementary Fig. S2. Maximum-parsimony tree derived from the 16S rRNA gene sequences of strains PS T and RS-7-1 and their taxonomic neighbours. The 16S rRNA gene sequence of Brevibacterium linens DSM T (X77451) was used as the outgroup. Bootstrap values (>70 %) based on 1000 replicates are shown at branch nodes.

Supplementary Fig. S3. Two-dimensional thin-layer chromatogram of polar lipids from strains PS T (A) and RS-7-1 (B). Abbreviations: DPG, diphosphatidylglycerol; PG, phosphatidylglycerol; PI, phosphatidylinositol; PIM: phosphatidylinositol mannoside. Chloroform-methanol-water (65:25:4) by volume was used in the first direction and chloroform-acetic acid-methanol-water (80:18:12:5) by volume in the second direction. The spray reagent, 5 % molybdophosphoric acid. DPG PG PI 1st 2nd DPG PG PIM PI PIM 1st 2nd (A)(B)