Biological databases Nicky Mulder:

What is a database an organized body of related infomation Data collection that is: –Structured (computer readable) –Searchable –Updatable –Cross-linked –Publicly available

Biological Databases Make data available to public So much data available, needs ordering Turn data into computer-readable form Ability to retrieve data from various sources Can have primary (archival) or secondary databases (curated) Most commonly used are sequence databases

Biological systems Taxonomic data Literature Protein folding and 3D structure Small molecules Pathways and networks Biological systems Protein families and domains Whole genome data Sequence data

Biological systems Taxonomic data Literature Protein folding and 3D structure Small molecules Pathways and networks Biological systems Protein families and domains Whole genome data Sequence data

Biological systems Taxonomic data Literature Protein folding and 3D structure Small molecules Pathways and networks Biological systems Protein families and domains Whole genome data Sequence data Ontologies -GO

Sequence databases Used for retrieving a known gene/protein sequence Useful for finding information on a gene/protein Can find out how many genes are available for a given organism Can comparing your sequence to the others in the database Can submit your sequence to store with the rest Main databases: nucleotide and protein sequence DBs

Requirements for good sequence database It must be complete with minimal redundancy It must contain as much up-to-date information (annotation) as possible on each sequence All the information items must be retrievable by computer programs in a consistent manner It must be highly interoperable with other databases

Nucleotide sequence databases EMBL, DDBJ, GenBank Data submitted by sequence owner Must provide certain information and CDS if applicable No additional annotation added Entries never merged –some redundancy Promoter Exons CDS (coding sequence)

Example EMBL entry 1: general info ID AB standard; genomic DNA; MAM; 6116 BP. AC AB083336; XX SV AB DT 06-JAN-2005 (Rel. 82, Created) DT 06-JAN-2005 (Rel. 82, Last updated, Version 1) DE Sus scrofa p27Kip1 gene for p27Kip1, p27Kip1R, complete cds, alternative DE splicing. OS Sus scrofa (pig) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Cetartiodactyla; Suina; Suidae; Sus. RN [1] RP RA Hirano K., Shintani Y., Hirano M., Kanaide H.; RT ; RL Submitted (08-APR-2002) to the EMBL/GenBank/DDBJ databases. RL Katsuya Hirano, Graduate School of Medical Sciences, Kyushu University, RL Division of Molecular Cardiology, Research Institute of Angiocardiology; RL Maidashi, Higashi-ku, Fukuoka, Fukuoka, , Japan RL Tel: , RL Fax: ) RN [2] RA Shintani Y., Hirano K., Hirano M., Nishimura J., Nakano H., Kanaide H.; RT "Cloning and Charaterization of full sequence of porcine p27Kip1 gene and RT expression of splice isoform p27Kip1R"; RL Unpublished. References Description of gene Accession number

Example EMBL entry 2: features on the sequence -CDS FH Key Location/Qualifiers FT source FT /db_xref="taxon:9823" FT /mol_type="genomic DNA" FT /organism="Sus scrofa" FT /cell_type="liver" FT /clone_lib="lambda Fix II porcine genomic DNA" FT exon FT /evidence=NOT_EXPERIMENTAL FT /note="The residue 2591 corresponds to the transcription FT initiation site determined in human gene" FT CDS join( , , ) FT /codon_start=1 FT /gene="p27Kip1" FT /product="p27Kip1R" FT /protein_id="BAD " FT /translation="MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDL FT EKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQ FT EGQGVSGTRQAVPLIGSQANSEDTHLVDQKTDAPDSQTGLAEQCTGIRKRPATDDSSPP FT SVSLKIGMYQLNYSSVW" Corresponding protein sequence Feature type and location Feature name and information

FT intron FT /cons_splice=(5'site:NO,3'site:NO) FT exon FT /number=2 FT intron FT /cons_splice=(5'site:NO,3'site:NO) FT exon FT /note="ending at a putative poly A site following a polyA FT signal" FT /number=3 FT polyA_signal XX SQ Sequence 6116 BP; 1583 A; 1392 C; 1438 G; 1703 T; 0 other; gcggccgcga gctcaattaa ccctcactaa agggagtcga ctcgatctcg aagccctttt 60 cttgttttta ttgagggaga gcttgggttc agaatacatt acaaatgcag catctattcc 120 agtctactta tagaaagacg tcctcctggg cttcccccct aagccccctg cctcccctag 180 aacagcacag acttctaggt taagggtgag ctaaccactg ctcaccccca gctaaggcac 240 ccaggctcag gggctccccg cctcccccgc tgagcgagcg gtgggggccc ccccgggaga 300 gagcccagct gggggccgag cgcccagcgg cgagcccagc tgcccgcccc tacccgctcg 360 gcgagcgagg ggaaaataag atcgccctcg gcgaggagag ggaggtcggg gctccggagc 420 Example EMBL entry 3: features on the sequence – introns and exons DNA sequence

Summary of information in EMBL entries Describes sequence type, e.g. genomic DNA, RNA, EST Provides taxonomy from which sequence came Provides information on submitters and references Describes features on a sequence NB for function, replication, recombination, structure etc. Shows if the DNA encodes a protein (CDS) and provides protein sequence Provides actual nucleotide sequence

Protein sequences DNA RNA Protein S S Ac Protein cleavage Protein modification Transported to organelle or membrane Folded into secondary or tertiary structure Performs a specific function All this info needs to be captured in a database

Protein Sequence Databases UniProt: –Swiss-Prot –manually curated, distinguishes between experimental and computationally derived annotation –TrEMBL - Automatic translation of EMBL, no manual curation, some automatic annotation GenPept -GenBank translations RefSeq - Non-redundant sequences for certain organisms IPI –International protein Index –combination of many protein sequence databases

Example of a Swiss-Prot entry 1 References General information

Example of a Swiss-Prot entry 2 Cross- references Functional information

Example of a Swiss-Prot entry 3 Keywords Features Sequence

Swiss-Prot annotation mainly found in: Description (DE) lines –Protein name/function Comment (CC) lines –e.g. function, subcellular location, pathway, cofactor, disease, etc. Feature table (FT) –features on the sequence, e.g. domain, active site, modifications, variations, etc. Keyword (KW) lines –Set of a few hundred controlled vocabulary terms

Other parts to UniProt UniParc –archive of all sequences UniProt –Swiss-Prot + TrEMBL UniProt NREF100 (100% seqs merged) UniProt NREF90 (90% seqs merged) UniProt NREF50 (50% seqs merged)

Submitting sequences to EMBL or UniProt WEB-IN -web-based submission tool for submitting DNA sequences to EMBL database. Protein sequences submitted when the peptides have been directly sequenced. Submit through SPIN

Sequence formats Not MSWord, but text! Most include an ID/name/annotation of some sort FASTA, E.g. >xyz some other comment ttcctctttctcgactccatcttcgcggtagctgggaccgccgttcagtcgc caatatgcgctctttgtccgcgcccaggagctacacaccttcgaggtga ccggccaggaaacggtcgccagatcaaggctcatgtagcctcactgg Others specific to programs, e.g. GCG, abi, clustal, etc.

Literature database: PubMed/Medline Source of Medical-related & scientific literature PubMed has articles published after 1965 Can search by many different means, e.g. author, title, date, journal etc., or keywords for each Can save queries and results Can usually retrieve abstracts and full papers PubMed has list of tags to search specific fields, e.g. [AU], [TI], [DP] etc.

Search fields in PubMed Title Words [TI]MeSH Terms [MH] Title/Abstract Words [TIAB]Language [LA] Text Words [TW]Journal Title [TA] Substance Name [NM] Issue [IP] Subset [SB]Filter [FILTER] Secondary Source ID [SI]Entrez Date [EDAT] Subheadings [SH] EC/RN Number [RN] Publication Type [PT]Author Name [AU] Publication Date [DP]All Fields [ALL] Personal Name as Subject [PS]Affiliation [AD] Page Number [PG]Unique Identifiers [UID] Title Words [TI] MeSH Major Topic [MAJR] MeSH Date [MHDA]

Taxonomy Databases Most used is NCBI’s taxonomy database: omy Provides entries for all known organisms Provides taxonomic lineage and translation table for organisms Sequence entries for organism UniProt-specific taxonomy database is Newt:

Example taxonomy entry

Where to find the databases Table of addresses for major databases and tools Nucleic Acids Research Database issue January each year Nucleic Acids Research Software issue –new Amos’s list of tools: