Bacterial Genetics - Assignment and Genomics Exercise: Aims –To provide an overview of the development and.

Slides:



Advertisements
Similar presentations
Blast outputoutput. How to measure the similarity between two sequences Q: which one is a better match to the query ? Query: M A T W L Seq_A: M A T P.
Advertisements

BLAST Sequence alignment, E-value & Extreme value distribution.
Gapped Blast and PSI BLAST Basic Local Alignment Search Tool ~Sean Boyle Basic Local Alignment Search Tool ~Sean Boyle.
Bioinformatics Unit 1: Data Bases and Alignments Lecture 2: “Homology” Searches and Sequence Alignments.
Local alignments Seq X: Seq Y:. Local alignment  What’s local? –Allow only parts of the sequence to match –Results in High Scoring Segments –Locally.
Heuristic alignment algorithms and cost matrices
Database searching. Purposes of similarity search Function prediction by homology (in silico annotation) Function prediction by homology (in silico annotation)
1 1. BLAST (Basic Local Alignment Search Tool) Heuristic Only parts of protein are frequently subject to mutations. For example, active sites (that one.
Introduction to bioinformatics
Similar Sequence Similar Function Charles Yan Spring 2006.
BLAST.
1-month Practical Course Genome Analysis Lecture 3: Residue exchange matrices Centre for Integrative Bioinformatics VU (IBIVU) Vrije Universiteit Amsterdam.
Bioinformatics Unit 1: Data Bases and Alignments Lecture 3: “Homology” Searches and Sequence Alignments (cont.) The Mechanics of Alignments.
Alignment IV BLOSUM Matrices. 2 BLOSUM matrices Blocks Substitution Matrix. Scores for each position are obtained frequencies of substitutions in blocks.
Rationale for searching sequence databases June 22, 2005 Writing Topics due today Writing projects due July 8 Learning objectives- Review of Smith-Waterman.
Blast heuristics Morten Nielsen Department of Systems Biology, DTU.
Sequence alignment, E-value & Extreme value distribution
Sequence comparison: Score matrices Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas
Sequence comparison: Significance of similarity scores Genome 559: Introduction to Statistical and Computational Genomics Prof. James H. Thomas.
1 BLAST: Basic Local Alignment Search Tool Jonathan M. Urbach Bioinformatics Group Department of Molecular Biology.
Alignment Statistics and Substitution Matrices BMI/CS 576 Colin Dewey Fall 2010.
Pairwise Alignment How do we tell whether two sequences are similar? BIO520 BioinformaticsJim Lund Assigned reading: Ch , Ch 5.1, get what you can.
An Introduction to Bioinformatics
BLAST What it does and what it means Steven Slater Adapted from pt.
Basic Introduction of BLAST Jundi Wang School of Computing CSC691 09/08/2013.
Sequence Alignment Goal: line up two or more sequences An alignment of two amino acid sequences: …. Seq1: HKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITN-EYMKEDFLIKIETWHKP.
Pairwise Sequence Alignment. The most important class of bioinformatics tools – pairwise alignment of DNA and protein seqs. alignment 1alignment 2 Seq.
Eric C. Rouchka, University of Louisville Sequence Database Searching Eric Rouchka, D.Sc. Bioinformatics Journal Club October.
Searching Molecular Databases with BLAST. Basic Local Alignment Search Tool How BLAST works Interpreting search results The NCBI Web BLAST interface Demonstration.
Local alignment, BLAST and Psi-BLAST October 25, 2012 Local alignment Quiz 2 Learning objectives-Learn the basics of BLAST and Psi-BLAST Workshop-Use BLAST2.
What is BLAST? BLAST® (Basic Local Alignment Search Tool) is a set of similarity search programs designed to explore all of the available sequence databases.
BLAST Anders Gorm Pedersen & Rasmus Wernersson. Database searching Using pairwise alignments to search databases for similar sequences Database Query.
1 P6a Extra Discussion Slides Part 1. 2 Section A.
NCBI resources II: web-based tools and ftp resources Yanbin Yin Fall 2014 Most materials are downloaded from ftp://ftp.ncbi.nih.gov/pub/education/ 1.
Comp. Genomics Recitation 3 The statistics of database searching.
Construction of Substitution Matrices
Function preserves sequences Christophe Roos - MediCel ltd Similarity is a tool in understanding the information in a sequence.
BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha.
BLAST Slides adapted & edited from a set by Cheryl A. Kerfeld (UC Berkeley/JGI) & Kathleen M. Scott (U South Florida) Kerfeld CA, Scott KM (2011) Using.
Significance in protein analysis
Basic Local Alignment Search Tool BLAST Why Use BLAST?
Database search. Overview : 1. FastA : is suitable for protein sequence searching 2. BLAST : is suitable for DNA, RNA, protein sequence searching.
Pairwise Sequence Alignment Part 2. Outline Summary Local and Global alignments FASTA and BLAST algorithms Evaluating significance of alignments Alignment.
Sequence Alignment.
Construction of Substitution matrices
David Wishart February 18th, 2004 Lecture 3 BLAST (c) 2004 CGDN.
Step 3: Tools Database Searching
The statistics of pairwise alignment BMI/CS 576 Colin Dewey Fall 2015.
©CMBI 2005 Database Searching BLAST Database Searching Sequence Alignment Scoring Matrices Significance of an alignment BLAST, algorithm BLAST, parameters.
MGM workshop. 19 Oct 2010 Some frequently-used Bioinformatics Tools Konstantinos Mavrommatis Prokaryotic Superprogram.
Summer Bioinformatics Workshop 2008 BLAST Chi-Cheng Lin, Ph.D., Professor Department of Computer Science Winona State University – Rochester Center
BLAST: Database Search Heuristic Algorithm Some slides courtesy of Dr. Pevsner and Dr. Dirk Husmeier.
Techniques for Protein Sequence Alignment and Database Searching G P S Raghava Scientist & Head Bioinformatics Centre, Institute of Microbial Technology,
Using BLAST To Teach ‘E-value-tionary’ Concepts Cheryl A. Kerfeld 1, 2 and Kathleen M. Scott 3 1.Department of Energy-Joint Genome Institute, Walnut Creek,
Substitution Matrices and Alignment Statistics BMI/CS 776 Mark Craven February 2002.
9/6/07BCB 444/544 F07 ISU Dobbs - Lab 3 - BLAST1 BCB 444/544 Lab 3 BLAST Scoring Matrices & Alignment Statistics Sept6.
Pairwise Sequence Alignment and Database Searching
Sequence similarity, BLAST alignments & multiple sequence alignments
Blast Basic Local Alignment Search Tool
Basics of BLAST Basic BLAST Search - What is BLAST?
BLAST Anders Gorm Pedersen & Rasmus Wernersson.
BLAST.
Basic Local Alignment Search Tool
Sequence comparison: Significance of similarity scores
Alignment IV BLOSUM Matrices
Basic Local Alignment Search Tool
BLAST Slides adapted & edited from a set by
Sequence alignment, E-value & Extreme value distribution
BLAST Slides adapted & edited from a set by
1-month Practical Course Genome Analysis Iterative homology searching
Presentation transcript:

Bacterial Genetics - Assignment and Genomics Exercise: Aims –To provide an overview of the development and future development of our understanding of microbial genetic systems and their evolution –To initiate a review of the information in the course and bring topics together –To provide a chance for you to practice essay writing with assistance in planning and construction –To produce a short report on an on-line sequence search Your objective –To write an essay on time with sequence search report –To discuss with your group the seminar topics –To prepare one OH sheet the topics for discussion –To gain some help in essay writing and planning

Essay Title "The expansion of microbial genome and metagenomic data in recent years has had a profound impact on our understanding of microorganisms and their interactions with their environment" Deadline; LAST DAY OF THIS TERM Planning tutorial to be arranged 4 to 5 pages of A4 with references cited SEMINAR TOPIC 4 groups to meet nearer the time to prepare a list: Task: to prepare FIVE research applications/experiments arising from genome sequencing that should be pursued in the area of microbiology and the environment in the next 5 to 10 years Prioritise and discuss in final seminar One page report on sequence searches from on - line exercise Add one page of notes on discussion at seminar

Bacterial Genetics - Assignment and Genomics Exercises The BLAST programs (Basic Local Alignment Search Tools) A set of sequence comparison algorithms introduced in 1990 that are used to search sequence databases for optimal local alignments to a query.

. Program Description blastpCompares an amino acid query sequence against a protein sequence database. blastnCompares a nucleotide query sequence against a nucleotide sequence database. blastxCompares a nucleotide query sequence translated in all reading frames against a protein sequence database. You could use this option to find potential translation products of an unknown nucleotide sequence. tblastnCompares a protein query sequence against a nucleotide sequence database dynamically translated in all reading frames. tblastxCompares the six-frame translations of a nucleotide query sequence against the six-frame translations of a nucleotide sequence database. Please note that the tblastx program cannot be used with the nr database on the BLAST Web page because it is computationally intensive.

Calculating alignment scores. The raw score S for an alignment is calculated by summing the scores for each aligned position and the scores for gaps. In this figure, a DNA alignment is shown. In amino acid alignments, the score for an identity or a substitution is given by the specified substitution matrix (e.g. BLOSUM62). BLAST 2.0 and PSI- BLAST use "affine gap costs" which charge the score -a for the existence of a gap, and the score -b for each residue in the gap. A gap of k residues therefore receives a total score of -(a+bk) and a gap of length 1 receives the score -(a+b). Gap creation and extension variables a and b are inherent to the scoring system in use (BLAST 2.0 defaults).

P value The probability of an alignment occurring with the score in question or better. The p value is calculated by relating the observed alignment score, S, to the expected distribution of HSP scores from comparisons of random sequences of the same length and composition as the query to the database. The most highly significant P values will be those close to 0. P values and E values are different ways of representing the significance of the alignment. E value Expectation value. The number of different alignments with scores equivalent to or better than S that are expected to occur in a database search by chance. The lower the E value, the more significant the score.

Lambda Ratio To convert a raw score S into a normalized score S' expressed in bits, one uses the formula S' = (lambda*S - ln K)/(ln 2), where lambda and K are parameters dependent upon the scoring system (substitution matrix and gap costs) employed [7-9]. For determining S', the more important of these parameters is lambda. The "lambda ratio" quoted here is the ratio of the lambda for the given scoring system to that for one using the same substitution scores, but with infinite gap costs [8]. This ratio indicates what proportion of information in an ungapped alignment must be sacrificed in the hope of improving its score through extension using gaps. We have found empirically that the most effective gap costs tend to be those with lambda ratios in the range 0.8 to 0.9. K A statistical parameter used in calculating BLAST scores that can be thought of as a natural scale for search space size. The value K is used in converting a raw score (S) to a bit score (S'). lambda A statistical parameter used in calculating BLAST scores that can be thought of as a natural scale for scoring system. The value lambda is used in converting a raw score (S) to a bit score (S').

3. dbj|BAA29916| (AP000003) 170aa long hypothetical protein [P e-23dbj|BAA29916| sp|Q57951|Y531_METJA HYPOTHETICAL PROTEIN MJ0531 >gi| e-18sp|Q57951|Y531_METJA91 5. gi| (AE000872) conserved protein [Methanobacterium t e-16gi| gi| (AE000865) conserved protein [Methanobacterium t e-15gi| gi| (AE000803) conserved protein [Methanobacterium t e-15gi| Sequences producing significant alignments:Score(bits)E Value 1.sp|Q57997|Y577_METJA PROTEIN MJ0577 >gi| |pir||A e-85sp|Q57997|Y577_METJA314 2.pdb|1MJH| Structure-Based Assignment Of The Biochemical F e-72pdb|1MJH| 272