So You Found a Gene ? NOW WHAT ??. How do we determine a genes function? We can infer certain roles based on sequence comparisons (Couple Weeks Ago) These.

Slides:

Advertisements

Similar presentations

10 September, 2004 Advanced Methods. Degenerate Oligonucleotides Short amino acid sequences can be used to create degenerate oligonucleotides. PCR primers.

Advertisements

Signaling and the Signal Transduction Cascade. Question?????? External Stimulus Inside cell Nucleus, Gene transcription Other cellular effects.

Recombinant DNA Method- Mutagenesis By: Jessica Green.

Mutagenesis Methods Lily Peterson April 5 th, 2010.

Molecular Genetics Introduction to The Structures of DNA and RNA

Mutations Section 12–4 This section describes and compares gene mutations and chromosomal mutations.

What are the three steps in PCR?. Denaturation Hybridization of Primer DNA replication.

Section 8.4: Transcription.

Fig. S1 A622 1 MVVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVT 60 A622L V V A622.

DNA in classifying species. Traditional classification Classification of organisms into closely related species, then more distant genuses, phyla and.

Mutation  Is a change in the genetic material.  Structural change in genomic DNA which can be transmitted from cell to it is daughter cell.  Structural.

Chapter 28 Manipulating DNA. Chapter Objectives Know how the techniques of molecular biology work Understand how to use the tools of molecular biology.

DNA Technology- Cloning, Libraries, and PCR 17 November, 2003 Text Chapter 20.

Applications and Basic Technology.  Recombinant DNA technology : set of techniques for recombining genes from different sources and transferring into.

歐亞書局 PRINCIPLES OF BIOCHEMISTRY Chapter 9 DNA-Based Information Technologies.

Biotechnology Packet #12 Chapter #9. Introduction Since the 1970’s, humans have been attempted to manipulate and modify genes in a way that was somewhat.

DNA Technologies.

Information Today –Chapter 14 and 16 highlights Wed., 30 November –Final exam review – BRING YOUR QUESTIONS! –Instructor evaluations Mon., 12 December,

Remember the limitations? –You must know the sequence of the primer sites to use PCR –How do you go about sequencing regions of a genome about which you.

Manipulation of DNA. Restriction enzymes are used to cut DNA into smaller fragments. Different restriction enzymes recognize and cut different DNA sequences.

Fluorescence Imaging with One Nanometer Accuracy (1.5 nm, msec) Site-Directed Mutagenesis to Isolate and Mutate DNA (for FIONA)

Recombinant DNA Technology. Restriction endonucleases - Blunt ends and Sticky ends.

CHMI 4226E - W20051 Recombinant DNA Technology CHMI 4226 E Week of March 2, 2009 Mutagenesis.

Transfection of Mammalian Cells MBIOS 520/420 October 6, 2005.

Chapter 10: Molecular Biology of Gene Expression Jones and Bartlett Publishers © 2005.

Cdc14p: A Mitotic Phosphatase Chelsi Kaiser, Whitney Franklin, & Dr. Kim Simons.

DNA Technology Chapter 11. Genetic Technology- Terms to Know Genetic engineering- Genetic engineering- Recombinant DNA- DNA made from 2 or more organisms.

Daily Trivia There are more bacteria and microbes in our body than actual cells that make up the body.

Caption N-terminal domain A/B domain: ligand-independent domain AF1: Activation Function 1 DBD: DNA Binding Domain LBD: Ligand Binding Domain: ligand-dependent.

Recombinant DNA Technology Genetic engineering requires copies of a specific sequence of DNA ( gene) that codes for 1 protein. Example: 1. The jellyfish.

Human Influence on Genes. Why Analyze DNA? Check for diseases Check for diseases Identify parents Identify parents Crime scene investigations Crime scene.

Recombinant DNA Technology. DNA replication refers to the scientific process in which a specific sequence of DNA is replicated in vitro, to produce multiple.

Chapter 11.6 Mutations. Definition- Mutation- a change in the DNA nucleotide sequence Mutation- a change in the DNA nucleotide sequence Types of mutations:

Ch 17 From Gene to Protein Proteins: the links from genotype to phenotype.

14. What is a microarray? What can be learned from it? (12.9)

Slide 1 of 24 Copyright Pearson Prentice Hall 12-4 Mutations 12–4 Mutations.

Mutations Can Change the Meaning of Genes CH 11 Section 6.

The Polymerase Chain Reaction (PCR)

DNA. DNA fingerprinting, DNA profiling, DNA typing  All terms applied to the discovery by Alec Jeffreys and colleagues at Leicester University, England.

Da-Hyeong Cho Protein Engineering Laboratory Department of Biotechnology and Bioengineering Sungkyunkwan University Site-Directed Mutagenesis.

Site-Directed Mutagenesis

이희두. Polymerase Chain Reaction  Technique widely used in molecular biology  With PCR it is possible to amplify a single or few copies of DNA across.

Mutation. What you need to know How alteration of chromosome number or structurally altered chromosomes can cause genetic disorders How point mutations.

Chapter 17 From Gene to Protein.

Basic Tools: Recombinant DNA Techniques Cut Purified DNA with Restriction Enzymes Transform E. coli Purified plasmid DNA Various restriction enzymes T4.

SC.912.L.16.3 DNA Replication. – During DNA replication, a double-stranded DNA molecule divides into two single strands. New nucleotides bond to each.

Variation among organisms

Figure 20.0 DNA sequencers DNA Technology.

Chapter 21 Nucleic Acids and Protein Synthesis

PCR Polymerase Chain Reaction

Reads aligned into contigs

Molecular Cloning: Polymerase Chain Reaction

Cloning Overview DNA can be cloned into bacterial plasmids for research or commercial applications. The recombinant plasmids can be used as a source of.

The Genetic Code Spring 2017.

Chapter 21 Nucleic Acids and Protein Synthesis

Chapter 21 Nucleic Acids and Protein Synthesis

Transcription -The main purpose of transcription is to create RNA from DNA because RNA leaves the nucleus to carry out its functions but DNA does not -A.

Notes 13.1 DNA.

DNA & The Genetic Code The sequence (order) of bases in a strand of DNA acts as a template for DNA replication and makes the code for building proteins.

DNA Technology Packet #50 Chapter #20.

MB&B 208: Molecular Biology

Cellular Metabolism Chapter 4

STAT Genes Found in C. elegans

Structural evidence: Embryonic similarities Vestigial organs

Transcription and RNA’s role

Thanks to Dr. Pierre Laneuville and

Copyright Pearson Prentice Hall

Phosphorylation Addition of a phosphate (PO4) group to a protein or other organic molecule. Phosphorylation activates or deactivates many protein enzymes,

Presentation transcript:

So You Found a Gene ? NOW WHAT ??

How do we determine a genes function? We can infer certain roles based on sequence comparisons (Couple Weeks Ago) These roles are not concrete without experimental data For Example:the NEW protein is a kinase (based on sequence) but without showing that the kinase domain is necessary for function this is not confirmed. How would this be possible using the techniques we have available?

How do we determine a genes function? The function of a gene (or Section of a Gene) can be determined using Two methods along with Transgenesis. Site-directed Mutagenesis: Single/Double Amino Acid Changes Small Deletions Domain Mutagenesis: Large sections (Domains) of a gene product are removed

Site-Directed Mutagenesis Involves Specific Base-pair changes in a DNA sequence. Can be done in several ways: PCR mediated Vector mediated Very useful in determining the role of active site residues, residues that are believed to be phosphorylated, etc.

How does it work ? In site-directed mutagenesis Primers are deisgned which contain a small area that is different and a large area that is identical to the ‘Normal’Gene Sequence. When a Polymerase incorporates this primer the change is made in one copy of the resulting products. Some methods then select for the ‘Altered’ Version. A C G T C T A G A A C G C C T A G A A TR T S R

Vector Mediated

Removing Domains A KinaseC NEW Kinase Design PCR Primers which ‘JUMP’ B AC Protein without Kinase Domain