STEPHANIE HINTZEN BIOL 471 SIV and HIV: Differences in Diversity and Divergence.

Slides:

Advertisements

Similar presentations

Changes In Protein Sequences Of the HIV-1 gp120 V3 Region In Non-Progressor Types Nicki S.Harmon Samantha M. Hurndon.

Advertisements

Undergraduate Exercises with Trp Cage Paula Evans, Chet Fornari, Jeff Hansen, Jennifer Inlow, Larry Merkle.

Genetic Similarities Between HIV-1 Viruses in the Onset of AIDS Isabel Gonzaga BIOL : Bioinformatics Laboratory Loyola Marymount University October.

Molecular Clock I. Evolutionary rate Xuhua Xia

Bioinformatics and Phylogenetic Analysis

Examination of Amino Acid Differences as a Means of Determining Functional Changes in HIV-1 Protein Sequences Chris Rhodes and Isaiah Castaneda Loyola.

1 BLAST: Basic Local Alignment Search Tool Jonathan M. Urbach Bioinformatics Group Department of Molecular Biology.

Analysis of HIV Evolution Bobak Seddighzadeh and Kristoffer Chin Department of Biology Loyola Marymount University Bio February 23, 2010.

Examining Subjects of HIV-1 With Possible Predominant Viral Strains Samantha Hurndon Isaiah Castaneda.

Unconserved Amino Acid Sequences in V3 Domain of gp120 Show No Significant Correlation to Altered Folding and Function Bobak Seddighzadeh Alex George.

Using Molecular Information to Investigate the Evolutionary Origin of the HIV Virus.

Re evaluating the Categorization of HIV Progression in Subjects Based on CD4 T cell Decline Rates Angela Garibaldi & Ryan Willhite Loyola Marymount University.

A Mutational Investigation of an HIV Patient’s GP120 Glycoprotein and it’s Implications on CD4 Binding Salita Kaistha Usrinus College, Collegeville PA.

MVKFLFSVIILFFLLSAVGSSARNIEEDGVIRLPSEVKDFINGKNIDDDSVGGTRWAVLI 60 AGSSGYWNYRHQADVCHAYQVLKRGGVKDENIVVFMYDDIALNEENPRPGVIINHPKGED 120 VYAGVPKDYTGRDVTAHNFYSVLLGNKTAVKGGSGKVIDSGPNDHIFIYYSDHGGPGVLG.

ARE THESE ALL BEARS? WHICH ONES ARE MORE CLOSELY RELATED?

Cyclins Presentation1 Cyclin family of the yeast S. cerevisiae: Biological vs. Bioinformatical Presented by: Tzvika HoltzmanYan Tsitrin.

Predicting the Onset of AIDS Robert Arnold, Alex Cardenas, Zeb Russo LMU Biology Department 10/5/2011.

Patterns of selection for or against amino acid change among different CD4 T-cell count progressor groups Michael Pina, Salomon Garcia Journal Club Presentation.

Diversity and Divergence in HIV-1 Viral Variants between patients with high CD4+ T Cell Variability and Patients with Rapid CD4+ T Cell Decline Kevin Paiz-Ramirez.

Mutations on the V3 loop of gp120 may predict progression to AIDS Derese Getnet, Dr. Rebecca Roberts, Structural Biology, Ursinus College, Collegeville.

Amino Acid Sequences in V3 Loop Conformation Alex Cardenas, Bobby Arnold and Zeb Russo Loyola Marymount University Department of Biology BIO /02/11.

Predicting the Onset of AIDS Robert Arnold, Alex Cardenas, Zeb Russo LMU Biology Department 10/5/2011.

Residue Sequence and Structure in the Re evaluation the Categorization of HIV Progression in Subjects Based on CD4 T cell Decline Rates Angela Garibaldi.

Examining Subjects of HIV-1 With Possible Predominant Viral Strains Samantha Hurndon Isaiah Castaneda.

Analyzing Differences in Protein Sequences Between Subjects with Varying T Cell Counts J’aime Moehlman Amanda Wavrin Loyola Marymount University March.

1 Molecular evidence of HIV transmission in a criminal case Metzker, Michael L. et al. (2002) Proc. Natl. Acad. Sci. USA 99,

Changes In Protein Sequences Of the HIV-1 gp120 V3 Region In Non-Progressor Types Nicki S.Harmon Samantha M. Hurndon LMU Department of Biology BIOL 368.

Examining the Genetic Similarity and Difference of the Three Progressor Groups at the First and Middle Visits Nicole Anguiano BIOL398: Bioinformatics Laboratory.

Examining Genetic Similarity and Difference of the Three Progressor Groups at the First and Middle Visits Nicole Anguiano Bioinformatics Laboratory Loyola.

V3 Loop Binding to CCR5 and CXCR4 of Rapid and Non Progressor HIV Patients in Baltimore MD BackgroundCCR5 and CXCR4 Receptor Rapid-progressor Patient 10.

Residue Sequence and Structure in the Re evaluation the Categorization of HIV Progression in Subjects Based on CD4 T cell Decline Rates Angela Garibaldi.

Student Project Showcase – April 2008 Classroom Pearls for Life Sciences and Mathematics Students J. de Varona, E. Demirci, S. Koksal S2 Figure 1: Photo.

Examining Genetic Similarity and Difference of the Three Progressor Groups at the First and Middle Visits Nicole Anguiano BIOL398: Bioinformatics Laboratory.

Investigations of HIV-1 Env Evolution Evolutionary Bioinformatics Education: A BioQUEST Curriculum Consortium Approach Grand Valley State University August.

Patterns of HIV-1 evolution in individuals with differing rates of CD4 T cell decline Markham RB, Wang WC, Weisstein AE, Wang Z, Munoz A, Templeton A,

Journal Club Presentation BIOL368/F16: Bioinformatics Laboratory

Colin Wikholm William Fuchs

Unrooted phylogenetic tree showing the relationship between the human SLC2A gene family for all 14 members created using PHYLIP 3.6 softwareDistance between.

Amino Acid Sequences in V3 Loop Conformation

Generating Multiple Sequence Alignments with ClustalW

The V3 Region Expresses More Diversity in Amino Acid Sequence in AIDS Diagnosed Patients than in Non-Trending and AIDS Progressing Patients HIV Structure.

Do HIV+ Rapid Progressors Show More Divergence than Non-Progressors?

Amino Acid Sequences in V3 Loop Conformation

Predicting the Onset of AIDS

مدیریت امور آزمایشگاهها دانشگاه علوم پزشکی کاشان

Nat. Rev. Endocrinol. doi: /nrendo

Blood Volume 92(10): November 15, 1998

Polydactyly L.A. Lettice, et al. Proc. Natl. Acad. Sci. USA 2002; 99(11):

Volume 2, Issue 3, Pages xi-xiii (July 2006)

Patterns of HIV-1 evolution in individuals with differing rates of CD4 T cell decline Markham RB, Wang WC, Weisstein AE, Wang Z, Munoz A, Templeton A,

D.P. Bartel Cell 136. Faller and Guo BBA 1779.

The 3D models in part a are reproduced with permission from Daum, B

Investigations of HIV-1 Env Evolution

Loyola Marymount University

LMU Department of Biology

Microtubule dynamic instability

Explore Evolution: Instrument for Analysis

Predicting the Onset of AIDS

Loyola Marymount University

Loyola Marymount University

Amino Acid Sequences in V3 Loop Conformation

Multiple sequence alignment & Phylogenetics Analysis

Patterns of HIV-1 evolution in individuals with differing rates of CD4 T cell decline Markham RB, Wang WC, Weisstein AE, Wang Z, Munoz A, Templeton A,

Phylogenetic analysis of PurR from low-GC Gram-positive bacteria.

Predicting the Onset of AIDS

Residue Sequence and Structure in the Re evaluation the Categorization of HIV Progression in Subjects Based on CD4 T cell Decline Rates Angela Garibaldi.

Chloe Jones, Isabel Gonzaga, and Nicole Anguiano

Phylogenetic analyses showing the relationship between Ruminococcus, Blautia, and Clostridium on the basis of the sequences of the 16S region for each.

Fig. 2 No evidence of HIV molecular evolution in diverse tissues obtained at autopsy (HAMB-1 and HAMB-2). No evidence of HIV molecular evolution in diverse.

Presentation transcript:

STEPHANIE HINTZEN BIOL 471 SIV and HIV: Differences in Diversity and Divergence

Markham HIV paper Island SIV paper Divergence  Rapid progressor had a significantly higher rate of increase over non  Rapid had a greater rate of increase but not significant over moderate  Moderate significant over nonprogressors Diversity  The differences in slope were significant between the rapid progressors and nonprogressors  Between nonprogressors and moderate progressors was significant  Moderate and rapid had a trend toward significant Divergence  Unknown! Diversity  Unknown! Background

The Question My thoughts Are the measurements of diversity and divergence of mutation less than, the same or greater in SIV than in HIV. There will be equal amounts of diversity and divergence between HIV and SIV Consider

Methods Use NCBI and genBank (FASTA) to retrieve sequences of SIV Use of Biology Workbench and ClustalW to align all sequences MEGA for diversity and divergence Weblogo

Methods

Results: ClustalW Phylogenetic tree  Rooted tree (generated by Phylip's Drawgram)

Results: Weblogo

Discussion Diversity  Coefficient of Differentiation  Divergence  Overall Distance/Divergence   HM and HM  89.3% identity  HM and HM  47.6% identity

References Markham R., et al Patterns of HIV -1 evolution in individuals with differing rates of CD4 T cell decline. Proc. Natl. Acad. Sci. USA:95, p Worobey M., et al Island Biogeography Reveals the Deep History of SIV. Science:329, 5998, p 1487