Glycopeptide MS/MS Spectra Supplemental Data 2. gi|310722811Vacuolar invertase 1 [Gossypium hirsutum] R.LFLFNNASGVNVK.A + Deamidated (NQ)1423.8701 01.

Slides:

Advertisements

Similar presentations

Conserved gene order in Basidiomycetes An investigation of synteny within and between: Laccaria bicolor Coprinopsis cinerea Phanerochaete chrysosporium.

Advertisements

Mechanism of hormone action

44 D (3 Khipu elements) Phaseolus vulgaris B4 locus 410 Kb contig 158 kb Sub- cluster C 400 Kb 300 Kb 250 Kb 200 Kb 150 Kb 100 Kb 50 Kb

Class I-A Class II-A Class II-B Class II- Basal Class I-B Class I Class II 0.1 Arabidopsis thaliana PHO1;H2 Capsella rubella PHO1;H Thellungiella.

Scarlet Runner Bean Genome Annotation: Contig

1 Eukaryotic Secretome Prediction and Knowledge-Base Development Xiang-Jia “Jack” Min Ph.D., Assistant Professor 2 nd International Conferences on Proteomics.

The Scarlet Runner Bean Genome: Contig By Eden Maloney.

Protein Structure Investigating DFR specificity in anthocyanin biosynthesis Fazeeda Hosein Sarasvati BahadurSingh Nigel Jalsa Cecilia Diaz David Gopaulchan.

2D-PAGE MS/MS Spectra Supplemental Data 1. Spot ID : GP 01 K.HYTAYDVDNWK.G gi| Beta-xylosidase/alpha-L-arabinofuranosidase [Medicago.

AP Bio: Chp.11 Cell Communication. G-protein-linked receptors: vary in their binding sites and for recognizing different G-proteins. Most have seven alpha.

Alfalfa (Medicago sativa). Sericea Lespedeza (Lespedeza cuneata)

ANALYSE DE L’EXPRESSION DE GÈNES STADE-SPÉCIFIQUES CHEZ LE PARASITE PROTOZOAIRE LEISHMANIA Barbara Papadopoulou, Ph.D. François McNicoll, Maxime Laverdière,

Scarlet Runner Bean Genome Assembly Nancy Phang June 4, 2004.

Essentials of Glycobiology Lecture 29 May 18, 2004 Plant Glycans Marilynn Etzler Section of Molecular and Cellular Biology University of California Davis,

Unfected > Infected AnnotationAccession numberGOName and other namesRDiscussed CDC45-related proteinCU apoptosis/cell cycle Cdc45l, Cdc451.11x Centrosomal.

Figure S1: Sequence of the mtr-miR159b backbone for amiRNA expression in pBluescriptII SK+ vector. AmiRNA constructs are generated from this template using.

WT L2 L3 L4 L5 L6 L15 L21 L23 L2 L5 L7 L8 BnSTM BrSTM BoSTM AtUBQ10 B A Supplementary Fig. 1 C WT L2 L3 L WTL2L5L7L WTL5L6L15L21.

1 Chapter 3: Protein ZHOU Yong Department of Biology Xinjiang Medical University.

AC CNR ACCNR 15 DPA B+7 A: 35 members E: 19 members B: 21 members C: 10 members D: 138 members F: 20 members G: 109 members H: 87 members I: 20 members.

Tel1: TcChr9-PGroup I HP*HP RNA pol IIIHP 8kb 1 Telomeric RepeatRHS* RHSBRCA2N-Acetiyltransferase*RNA helicase*ASF-1ATPaseSIRETS*TSVIPER/SIREL1TcVIPER/SIRERHS*DGF-1Phosphate.

Zeatin Cis-Trans Isomerase in Plants Tomáš HLUSKA Department of Molecular Biology Centre of the Region Haná for Biotechnological and Agricultural Research.

Transcriptome sequencing - a case study in Piper

HC70AL Final Presentation Chris McQuilkin June 4 th, 2009.

Supplemental Figure 1S. Alignment and phylogeny of CRY proteins. Comparison of the amino acid sequences of the DNA-photolyase domain (a) and FAD binding.

8. Protein Synthesis and Protein Processing a). Ribosome structure b). Protein synthesis i). Initiation of protein synthesis ii). Peptide bond formation;

Supplemental Fig. S1 extracellular (P=0.000) cell wall (P=0.000) ribosome (P=0.001) ER (P=0.294) golgi apparatus (P=0.005) plasma membrane (P=0.000) mitochondria.

Figure 1 Black bars = Small Intestine White Bars = Colon.

Figure S1. Effects of AVG, DIECA, DPI, NMMA, STA, and OKA on IbRPK expression in sweet potato (Ipomoea batatas cv. Tainung 57). Leaves with petiole cuts.

CHAPTER 13 Insulin Signaling. Figure 13.1 – General mechanism of signal transduction across a membrane Steps involved: 1. Release of primary messenger.

Cluster I. Cluster II Cluster III (contiued) Cluster IV.

10 th PBL in calcium- and phospholipid signaling May 3-14, 2010 Md. Shahidul Islam, M.D., Ph.D. Karolinska Instititet, Institutionen för klinisk forskning.

MiRNAPredicted targetsPutative function of targets miRC1GRMZM2G029833_T01DNA binding / DNA-directed RNA polymerase miRC4 GRMZM2G171796_T01; GRMZM2G355906_T03;

Transgenic Approach for Abiotic Stress Tolerance.

Cell Signaling. Local Signaling Paracrine Paracrine Synaptic Synaptic.

Fig. S1. Amino acid sequence alignment of MYBS3 proteins. MYBS3 protein sequences of Arabidopsis thaliana (MYBH; NP_199550); (At3g16350; NP_188256), Glycine.

Evolution of the Protein Kinase Family Michael Gribskov DEPARTMENT OF BIOLOGICAL SCIENCES.

LATE BLIGHT RESISTANCE PROTEIN RPI-BLB26 6 NBS-LRR RESISTANCE PROTEIN-LIKE PROTEIN6 LATE BLIGHT RESISTANCE PROTEIN RPI-BLB26 6 LATE BLIGHT RESISTANCE PROTEIN.

Supplementary Figures SHUGOSHINs and PATRONUS protect meiotic centromere cohesion in Arabidopsis thaliana Linda Zamariola 1, Nico De Storme 1, Katrijn.

Fig. S1. Carotenoid and chlorophyll composition of Arabidopsis Z-ISO mutants compared to wild type. Seedlings were grown for 6d on half strength MS plus.

SGPPname Crystals seen?ListEnzyme name PfAl007201WESYesWesthioredoxin PfAl006677WES WesCholine kinase PfAl008572WES Wescyclophilin-like PfAl004964WES WesProtein.

Journal: Molecular Breeding Molecular characterization of allelic variation in spontaneous brown midrib mutants of sorghum (Sorghum bicolor L Moench) Sunita.

Petr GALUSZKA Centre of the Region Haná for Biotechnological and Agricultural Research Palacký University in Olomouc FROM CYTOKININ METABOLISM TO AGRICULTURE.

Supplementary Fig. 1. (A) PCR amplification of wheat TaHSP26 genomic, cDNA and ORF clones. (B) ORF and protein sequence of TaHSP26. An arrowhead indicates.

CCAGTTGCCGCGTTCACCCTCTCCTCATCCGCGGTTCACCGGCCTCGTTGAGACTGCCTG  SCO0033 GGCCGTCATTCCGACAGCACCCACGTCTCACTCCCCGTGCCCATGCGGGGACCGGGCGGC CCGGCAGTAAGGCTGTCGTGGGTGCAGAGTGAGGGGCACGGGTACGCCCCTGGCCCGCCG.

WSSP Chapter 10 Literature Search Where do you learn about the function of your gene? atttaccgtg ttggattgaa attatcttgc atgagccagc tgatgagtat gatacagttt.

Protein. Protein and Roles 1: biological process unknown 1.1 Structural categories 1.2 organism categories 1.3 cellular component o unlocalized.

Supplementary Fig. 1 ClustalW (2.1) multiple sequence alignment and comparison of deduced partial protein sequences of SOS1 in root tissues of wheat genotypes.

“noisy” signal analysis

Gene discovery for delayed senescence in bioenergy crops to improve total biomass production Bimal Paudel, Mike Tran Jai Rohila, Jose Gonzalez, Arvid Boe,

S1 Table. The protein sequences Glycine max St8 MER3 and 18 homologous proteins used for phylogenetic analysis. S. No. Gene Name/ ID Protein type 1 Glyma.06G

(A) rRNA (B) OsAGPL3 rRNA (C) Time after transfer （h）

Metabolism 1: Catabolism

Suppl 4A Large black circles: query genes

Figure S1. Sequence alignment of Arabidopsis NodGS with other plant and fungal orthologues. Abbreviations are as follows: Populus trichocarpa (Ptr), Ricinus.

Toward Systems Understanding of Leaf Senescence: An Integrated Multi-Omics Perspective on Leaf Senescence Research Jeongsik Kim, Hye Ryun Woo, Hong Gil.

Volume 6, Issue 3, Pages (May 2013)

Motif 1 Motif 3 Motif 6 Motif 2 Motif 5 Motif 4 Motif 4 Motif 1

Volume 3, Issue 4, Pages (July 2010)

Cell to Cell Communication

Pyruvate Dehydrogenase

Volume 1, Issue 2, Pages (March 2008)

Plasma Membrane H+-ATPase Regulation in the Center of Plant Physiology

Toward Systems Understanding of Leaf Senescence: An Integrated Multi-Omics Perspective on Leaf Senescence Research Jeongsik Kim, Hye Ryun Woo, Hong Gil.

Mechanism of hormone action

Plant Growth Size & shape depends on cell # & cell size

G protein coupled receptors

Plasma Membrane H+-ATPase Regulation in the Center of Plant Physiology

Function introduction to G proteins (more details in another lecture)

Volume 3, Issue 2, Pages (March 2010)

Presentation transcript:

Glycopeptide MS/MS Spectra Supplemental Data 2

gi| Vacuolar invertase 1 [Gossypium hirsutum] R.LFLFNNASGVNVK.A + Deamidated (NQ) Supplemental Data 2

K.ITGSIPAGLTDLELQFMNVSYNR.L + Deamidated (NQ) gi| Polygalacturonase-inhibiting protein [Gossypium barbadense]02 Supplemental Data 2

K.TVDQYYFGGNNSIR.G + Deamidated (NQ) gi| Predicted protein [Populus trichocarpa]03 Supplemental Data 2

K.KDENMAGEWNYTSGK.W + Deamidated (NQ); Oxidation (M) gi| Hypothetical protein VITISV_ [Vitis vinifera] Calreticulin 04 Supplemental Data 2

R.TLANSNLPGFNNTLDR.L + Deamidated (NQ) gi| Apoplastic anionic gaiacol peroxidase [Gossypium hirsutum]05 Supplemental Data 2

R.TNLTASGPRPNPQGSYHY.G + Deamidated (NQ) gi| Unknown protein [Arabidopsis thaliana] Pectinesterase 06 Supplemental Data 2

R.DELDFEFLGNR.T + Deamidated (NQ) gi| Endo-xyloglucan transferase [Gossypium hirsutum]07 Supplemental Data 2

R.QYAGYVTVNESHGR.A + Deamidated (NQ) gi| Serine carboxypeptidase (carboxypeptidase D), putative [Musa acuminata] 08 Supplemental Data 2

K.AAESWVHDNVTR.Y + Deamidated (NQ) gi| Unnamed protein product [Vitis vinifera] Glucan endo-1,3-beta-glucosidase 9-like 09 Supplemental Data 2

R.VPTVNVSVVDLTVR.L + Deamidated (NQ) gi| Putative glyceraldehyde 3-phosphate dehydrogenase [Ophrys sphegodes] 10 Supplemental Data 2

R.MLLNDANSTGEKK.T + Deamidated (NQ); Oxidation (M) gi| Putative tetratricopeptide repeat(TPR)-containing protein [Oryza sativa Japonica Group] 11 Supplemental Data 2

R.WNVSASGAR.P + Deamidated (NQ) gi| Pollen-specific protein [Arabidopsis thaliana]12 Supplemental Data 2

R.WNVSASGARPNPQGSFR.Y + Deamidated (NQ) gi| Monocopper oxidase-like protein SKU5 [Medicago truncatula] 13 Supplemental Data 2

K.FPGPTINSTTNNNVVINVR.N + Deamidated (NQ) Cotton_D_gene_ Predicted protein [Populus trichocarpa] Monocopper oxidase-like protein SKU5 14

R.SANGNITPYLGNR.T + Deamidated (NQ) gi| Putative protein disulfide isomerase [Gossypium hirsutum] 15 Supplemental Data 2

R.DEIGNISSSHLR.T + Deamidated (NQ) gi| Unknown [Populus trichocarpa] PREDICTED: Dolichyl-diphosphooligosaccharide- -protein glycosyltransferase subunit 1 16 Supplemental Data 2

R.VPVGPTSGRTNDSAWR.A + Deamidated (NQ) gi| Hypothetical protein [Oryza sativa Japonica Group] 17 Supplemental Data 2

T.AEGNQVNVTTGVVNATVENSVFSDR.R + 2 Deamidated (NQ) gi| Fasciclin-like arabinogalactan protein 6 [Gossypium hirsutum] 18 Supplemental Data 2

A.YDPLDPNGNVTIK.W + Deamidated (NQ) gi| Unknown [Glycine max] COBRA-like protein 4-like19 Supplemental Data 2

T.YNGTNHLIK.K + Deamidated (NQ) gi| Calreticulin-1 [Arabidopsis thaliana] 20 Supplemental Data 2

K.CNGTKDSISK.L + Deamidated (NQ) gi| Unknown [Picea sitchensis] Triosephosphate isomerase 21 Supplemental Data 2

Q.YGIDKDFSNESR.H + Deamidated (NQ) gi| Predicted protein [Hordeum vulgare subsp. vulgare] Hypoxia up-regulated protein 1-like 22 Supplemental Data 2

Y.TFTAAELSNR.T + Deamidated (NQ) Cotton_D_gene_ Predicted protein [Populus trichocarpa] Dessication related protein 23

Supplemental Data 2 R.GVDEALNETVCVLDDCR.G + Deamidated (NQ)+ Carbamidomethylation Cotton_D_gene_ Lysosomal alpha mannosidase24

Supplemental Data 2 K.ATVDGQNISFLEAAR.S + Deamidated (NQ) Cotton_D_gene_ N-Carbamoyl-L-amino acid hydrolase-like [Vitis vinifera] 25

Supplemental Data 2 R.YHAHQYTNGTQCDLTNQPR.E + Deamidated (NQ)+ Carbamidomethylation Cotton_D_gene_ Conserved hypothetical protein [Ricinus communis] 26

Supplemental Data 2 K.TPVNISDAAHVR.K + Deamidated (NQ) Cotton_D_gene_ Predicted :glucosidase 2 subunit beta like [Vitis vinifera] 27

Supplemental Data 2 K.YNSTLSILR.L + Deamidated (NQ) Cotton_D_gene_ Epidermis specific secreted glycoprotein EP1-like [Gossypium hirsutum] 28

Supplemental Data 2 K.GGKFPLNVT.A+ Deamidated (NQ) Cotton_D_gene_ Fasciclin like arabinogalactan protein 6 [Gossypium hirsutum] 29

Supplemental Data 2 K.EANVSGVPVVR.L+ Deamidated (NQ) Cotton_D_gene_ Radial Swelling 3, glucosidase/hydrolase [Arabidopsis thaliana] 30

Supplemental Data 2 K.NVTQHITSNNVNIR.Y+ Deamidated (NQ) Cotton_D_gene_ Predicted: hypothetical protein [Vitis vinifera] glucan endo-1,3-beta-glucosidase 8 31

Supplemental Data 2 K.VLNLSSNQLSGDLPSSLR.S+ Deamidated (NQ) Cotton_D_gene_ Probable inactive receptor kinase [Vitis vinifera]32

Supplemental Data 2 R.NNSLTGALPPLLVTSPR.L+ Deamidated (NQ) Cotton_D_gene_ Probable inactive receptor kinase [Vitis vinifera]32

Supplemental Data 2 K.STQVANQLLGQLNNSNNGMTVFAPTDNAFSSLK.S + Deamidated (NQ) gi| Arabinogalactan protein [Gossypium hirsutum]33

Supplemental Data 2 R.TQAGDSGDGKFPLNITTSGN.S + Deamidated (NQ) gi| Arabinogalactan protein [Gossypium hirsutum]33

Supplemental Data 2 K.KPSLSNLTNDQLK.S + Deamidated (NQ) gi| Fasciclin-like arabinogalactan protein 2 [Gossypium hirsutum]34

Supplemental Data 2 K.VLDTFQNQANNTDQGITIFVPK.D + Deamidated (NQ) gi| Fasciclin-like arabinogalactan protein 2 [Gossypium hirsutum]34

Supplemental Data 2 K.ALTKPSLSNLTDDQFK.S + Deamidated (NQ) gi|606942Unknown [Gossypium hirsutum] Fascilin Like Arabinogalactan protein 3 35

Supplemental Data 2 Q.IQANNTVEGITIFVPK.D + Deamidated (NQ) gi|606942Unknown [Gossypium hirsutum] Fascilin Like Arabinogalactan protein 3 35

Supplemental Data 2 K.GDSMNLTIPEPGPTTIR.N + Deamidated (NQ); Oxidation (M) gi| Endo-alpha-1,4-glucanase [Gossypium hirsutum]36

Supplemental Data 2 K.SNNFSCAIVVVGEHPYVETK.G + Deamidated (NQ) gi| Endo-alpha-1,4-glucanase [Gossypium hirsutum]36

Supplemental Data 2 R.ITYPPHANYTY.S + Deamidated (NQ) gi| Endo-alpha-1,4-glucanase [Gossypium hirsutum]36

Supplemental Data 2 K.VDNITSILEK.G + Deamidated (NQ) gi| Fasciclin-like arabinogalactan protein 6 [Gossypium hirsutum] 37

Supplemental Data 2 K.FPLNVTAEGNQVNVTTGVVNATVENSVFSDR.R + 3 Deamidated (NQ) gi| Fasciclin-like arabinogalactan protein 6 [Gossypium hirsutum] 37

Supplemental Data 2 K.TVTVNDFVYSGLAATGNTSNLIK.A + Deamidated (NQ) gi| GLP3 [Gossypium barbadense] 38

Supplemental Data 2 R.EYQNTGPGANTSSR.V + Deamidated (NQ) gi| Pectin methylesterase [Gossypium hirsutum] 39

Supplemental Data 2 K.GYSVITNISEAQTYTAR.N + Deamidated (NQ) gi| Pectin methylesterase [Gossypium hirsutum] 39

Supplemental Data 2 R.DVVPLNVTR.H + Deamidated (NQ) gi| Copper binding protein 4 [Gossypium hirsutum] 40

Supplemental Data 2 K.TDYESCNADHPLHNWTTGAGR.D + Deamidated (NQ) gi| Copper binding protein 4 [Gossypium hirsutum] 40

Supplemental Data 2 R.SVLYDNK.T + Deamidated (NQ) gi| vacuolar invertase 1 [Gossypium hirsutum] 41

Supplemental Data 2 R.LFLFNNASGVNVK.A + Deamidated (NQ) gi| vacuolar invertase 1 [Gossypium hirsutum] 41

Supplemental Data 2 R.ACCGGGGPYNFNISAR.C + Deamidated (NQ) gi| PREDICTED: GDSL esterase/lipase At5g45910-like [Glycine max] 42

Supplemental Data 2 K.YYYEVGIGNSSR.R + Deamidated (NQ) gi| PAP1 [Gossypium hirsutum] 43

Supplemental Data 2 K.YFNYTSGFIH.H + Deamidated (NQ) gi| PAP1 [Gossypium hirsutum] 43

Supplemental Data 2 R.TQAGDSGDGEFPLNVTTSGNTVVLK.T + Deamidated (NQ) gi| Arabinogalactan protein 4 [Gossypium hirsutum] 44

Supplemental Data 2 K.VFNASGLR.K + Deamidated (NQ) gi| PREDICTED: PI-PLC X domain-containing protein At5g67130-like [Glycine max] 45

Supplemental Data 2 R.EASYGHSTLEIKNR.T + Deamidated (NQ) gi| Acid phosphatase [Lupinus luteus] 46

Supplemental Data 2 R.HLPNLNGTIQPAIAK.L + Deamidated (NQ) gi| Polygalacturonase-inhibiting protein [Gossypium barbadense] 47

Supplemental Data 2 K.CHLNVSNTR.D + Deamidated (NQ) gi| Unknown [Populus trichocarpa] 48

Supplemental Data 2 K.METSVINGTYR.G + Deamidated (NQ); Oxidation (M) gi| Predicted protein [Populus trichocarpa] 49

Supplemental Data 2 R.DGGNVSDITFSNINISTR.Y + 2 Deamidated (NQ) gi| Predicted protein [Populus trichocarpa] 50

Supplemental Data 2 Q.TVQLYTDQTGANISR.N + Deamidated (NQ) gi| Unknown [Picea sitchensis] 51

Supplemental Data 2 S.IKSNGEAIGAWNYTNAESFIR.F + Deamidated (NQ) gi| Heparanase-like protein 3 [Arabidopsis thaliana] 52

Supplemental Data 2 D.SFPPSQAFFNR.S + Deamidated (NQ) gi| Predicted protein [Populus trichocarpa] Glucan endo-1,3-beta-glucosidase 53

Supplemental Data 2 R.TQAGQDFGLNVTGLNNQVNVSSGVVETQINNALYQK.K + Deamidated (NQ) gi| fasciclin-like arabinogalactan protein 1 [Gossypium hirsutum] 54

Supplemental Data 2 R.TQAGQDFGLNVTGLNNQVNVSSGVVETQINNALYQK.K + Deamidated (NQ) gi| fasciclin-like arabinogalactan protein 1 [Gossypium hirsutum] 54

Supplemental Data gi| Serine carboxypeptidase, putative [Musa acuminata] 55 R.QYAGYVTVNESHGR.A+ Deamidated (NQ)

Supplemental Data 2 R.FFTESSGATLLNATLQK.D + Deamidated (NQ) Cotton_D_gene_ Alpha N-arabinofuranosidase 56

Supplemental Data 2 R.FFTESSGATLLNATLQK.D + Deamidated (NQ) Cotton_D_gene_ Predicted protein [Populus trichocarpa] Reticuline oxidase precursor 57

Supplemental Data 2 R.YNVSSGER.Y + Deamidated (NQ) Cotton_D_gene_ Purple acid phosphatase 58

Supplemental Data 2 R.EASYGHSTLEIQNR.T + Deamidated (NQ) Cotton_D_gene_ Purple acid phosphatase 58

Supplemental Data 2 K.IGPGISNITTIDEAER.I + Deamidated (NQ) Cotton_D_gene_ Protein disulfide isomerase 59

Supplemental Data 2 K.AEVAAAIKNETR.I + Deamidated (NQ) Cotton_D_gene_ Peroxidase 1 [Litchi chinensis] 60

Supplemental Data 2 R.SHIYNDSNIDPSFANSLR.R + Deamidated (NQ) Cotton_D_gene_ Peroxidase 1 [Litchi chinensis] 60

Supplemental Data 2 R.SGNDSVLAPLDR.Q + Deamidated (NQ) Cotton_D_gene_ Peroxidase 1 [Litchi chinensis] 60

Supplemental Data 2 R.VNDFIAAALAQANVTR.T + Deamidated (NQ) Cotton_D_gene_ Predicted protein [Populus trichocarpa] alpha-mannosidase 61

Supplemental Data 2 R.ASLNLTILK.K + Deamidated (NQ) Cotton_D_gene_ Unknown [Populus trichocarpa] GPI anchored glycoprotein membrane precursor 62

Supplemental Data 2 K.NQPCTNSTGANTVPGTEPQFANYPN LLAK.C + Deamidated (NQ) Cotton_D_gene_ Unknown [Populus trichocarpa] GPI anchored glycoprotein membrane precursor 62

Supplemental Data 2 N.DVINSTVQPYTFTAAELSNR.T + Deamidated (NQ) Cotton_D_gene_ Predicted protein [Populus trichocarpa] Dessication related protein 63

Supplemental Data 2 K.AEGLIVPLQLGAENR.T + Deamidated (NQ) Cotton_D_gene_ Predicted protein [Populus trichocarpa] Dessication related protein 63

Supplemental Data 2 S.MVFGTGNATMPGGLFPR.G + Deamidated (NQ) Cotton_D_gene_ Predicted protein [Populus trichocarpa] Dessication related protein 63

Supplemental Data 2 R.VNDFVAAAIAQANITR.T+ Deamidated (NQ) Cotton_D_gene_ Lysosomal alpha-mannosidase 64

Supplemental Data 2 K.VIDTFQNQANNTDQGITVFVPK.D + Deamidated (NQ) Cotton_D_gene_ Fasciclin –like arabinogalactan protein 2 [Gossypium hirsutum] 65

Supplemental Data 2 K.GEFNGSSISVLSR.N+ Deamidated (NQ) Cotton_D_gene_ Disease resistance responsive family [Arabidopsis thaliana] 66

Supplemental Data 2 K.VTDNPADELVAALNANR.T+ Deamidated (NQ) Cotton_D_gene_ Conserved hypothetical protein [Ricinus communis] 67

Supplemental Data 2 K.AGLLNESAIDK.A+ Deamidated (NQ) Cotton_D_gene_ Beta-xylosidase [Vitis vinifera] 68

Supplemental Data 2 R.TQAGDSGDGKFPLNVTTSGN.S+ Deamidated (NQ) Cotton_D_gene_ Arabinogalactan protein 2 [Gossypium hirsutum] 69

Supplemental Data 2 C.NLYNDPNTLASFNVTVPEALR.I+ Deamidated (NQ) Cotton_D_gene_ Lipid binding protein, putative [Ricinus communis] 70

Supplemental Data 2 N.LLTNSSANGTSPTADCCNSLK.T+ Deamidated (NQ) Cotton_D_gene_ Lipid binding protein, putative [Ricinus communis] 71

Supplemental Data 2 K.TVQLYTDQTGANISR.S+ Deamidated (NQ) Cotton_D_gene_ Exordium like protein [Arabidopsis thaliana] 72

Supplemental Data 2 G.GSAVGAWNYTNAESFIR.Y+ Deamidated (NQ) Cotton_D_gene_ Predicted: heparanase-like protein 3-like [Vitis vinefera] 73

Supplemental Data 2 G.GSAVGAWNYTNAESFIR.Y+ Deamidated (NQ) Cotton_D_gene_ Apoplastic anionic gaiacol peroxidase [Gossypium hirsutum] 74