2. Introduction to Rosetta and structural modeling (From Ora Schueler-Furman) Approaches for structural modeling of proteins The Rosetta framework and.

Slides:



Advertisements
Similar presentations
Functional Site Prediction Selects Correct Protein Models Vijayalakshmi Chelliah Division of Mathematical Biology National Institute.
Advertisements

Rosetta Energy Function Glenn Butterfoss. Rosetta Energy Function Major Classes: 1. Low resolution: Reduced atom representation Simple energy function.
Protein Structure Prediction using ROSETTA
Crystallography -- lecture 21 Sidechain chi angles Rotamers Dead End Elimination Theorem Sidechain chi angles Rotamers Dead End Elimination Theorem.
Andrzej Kolinski LABORATORY OF THEORY OF BIOPOLYMERS WARSAW UNIVERSITY Structure and Function of Biomolecules, Bedlewo,
Short fast history of protein design Site-directed mutagenesis -- protein engineering (J. Wells, 1980's) Coiled coils, helix bundles (W. DeGrado, 1980's-90's)
Protein Threading Zhanggroup Overview Background protein structure protein folding and designability Protein threading Current limitations.
Computing Protein Structures from Electron Density Maps: The Missing Loop Problem I. Lotan, H. van den Bedem, A. Beacon and J.C. Latombe.
Prediction to Protein Structure Fall 2005 CSC 487/687 Computing for Bioinformatics.
CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Homology Modeling Anne Mølgaard, CBS, BioCentrum, DTU.
Two Examples of Docking Algorithms With thanks to Maria Teresa Gil Lucientes.
Protein Docking and Interactions Modeling CS 374 Maria Teresa Gil Lucientes November 4, 2004.
Thomas Blicher Center for Biological Sequence Analysis
Protein Primer. Outline n Protein representations n Structure of Proteins Structure of Proteins –Primary: amino acid sequence –Secondary:  -helices &
FLEX* - REVIEW.
. Protein Structure Prediction [Based on Structural Bioinformatics, section VII]
CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Homology Modelling Thomas Blicher Center for Biological Sequence Analysis.
Protein Structure Prediction Samantha Chui Oct. 26, 2004.
Protein Structures.
Computational Structure Prediction Kevin Drew BCH364C/391L Systems Biology/Bioinformatics 2/12/15.
Protein Structure Prediction Dr. G.P.S. Raghava Protein Sequence + Structure.
Homology Modeling David Shiuan Department of Life Science and Institute of Biotechnology National Dong Hwa University.
Construyendo modelos 3D de proteinas ‘fold recognition / threading’
Practical session 2b Introduction to 3D Modelling and threading 9:30am-10:00am 3D modeling and threading 10:00am-10:30am Analysis of mutations in MYH6.
What are proteins? Proteins are important; e.g. for catalyzing and regulating biochemical reactions, transporting molecules, … Linear polymer chain composed.
COMPARATIVE or HOMOLOGY MODELING
CRB Journal Club February 13, 2006 Jenny Gu. Selected for a Reason Residues selected by evolution for a reason, but conservation is not distinguished.
Basic Computations with 3D Structures
02/03/10 CSCE 769 Dihedral Angles Homayoun Valafar Department of Computer Science and Engineering, USC.
2. Introduction to Rosetta and structural modeling Approaches for structural modeling of proteins The Rosetta framework and its prediction modes Cartesian.
 Four levels of protein structure  Linear  Sub-Structure  3D Structure  Complex Structure.
RNA Secondary Structure Prediction Spring Objectives  Can we predict the structure of an RNA?  Can we predict the structure of a protein?
Structural biology should be computable! Protein structures determined by amino acid sequences Protein structures and complexes correspond to global free.
Ab Initio Methods for Protein Structure Prediction CS882 Presentation, by Shuai C., Li.
Department of Mechanical Engineering
Part I : Introduction to Protein Structure A/P Shoba Ranganathan Kong Lesheng National University of Singapore.
Conformational Space.  Conformation of a molecule: specification of the relative positions of all atoms in 3D-space,  Typical parameterizations:  List.
Protein secondary structure Prediction Why 2 nd Structure prediction? The problem Seq: RPLQGLVLDTQLYGFPGAFDDWERFMRE Pred:CCCCCHHHHHCCCCEEEECCHHHHHHCC.
Doug Raiford Lesson 17.  Framework model  Secondary structure first  Assemble secondary structure segments  Hydrophobic collapse  Molten: compact.
New Strategies for Protein Folding Joseph F. Danzer, Derek A. Debe, Matt J. Carlson, William A. Goddard III Materials and Process Simulation Center California.
Protein Structure Prediction: Homology Modeling & Threading/Fold Recognition D. Mohanty NII, New Delhi.
Introduction to Protein Structure Prediction BMI/CS 576 Colin Dewey Fall 2008.
Protein Design with Backbone Optimization Brian Kuhlman University of North Carolina at Chapel Hill.
Structure prediction: Ab-initio Lecture 9 Structural Bioinformatics Dr. Avraham Samson Let’s think!
Programme Last week’s quiz results + Summary Fold recognition Break Exercise: Modelling remote homologues Summary.
. Protein Structure Prediction. Protein Structure u Amino-acid chains can fold to form 3-dimensional structures u Proteins are sequences that have (more.
Protein Folding & Biospectroscopy Lecture 6 F14PFB David Robinson.
Bioinformatics 2 -- lecture 9
Protein Structure and Bioinformatics. Chapter 2 What is protein structure? What are proteins made of? What forces determines protein structure? What is.
Query sequence MTYKLILNGKTKGETTTEAVDAATAEKVFQYANDN GVDGEWTYTE Structure-Sequence alignment “Structure is better preserved than sequence” Me! Non-redundant.
Structural classification of Proteins SCOP Classification: consists of a database Family Evolutionarily related with a significant sequence identity Superfamily.
Protein backbone Biochemical view:
Forward and inverse kinematics in RNA backbone conformations By Xueyi Wang and Jack Snoeyink Department of Computer Science UNC-Chapel Hill.
Topics in bioinformatics CS697 Spring 2011 Class 12 – Mar Molecular distance measurements Molecular transformations.
Mean Field Theory and Mutually Orthogonal Latin Squares in Peptide Structure Prediction N. Gautham Department of Crystallography and Biophysics University.
Ab-initio protein structure prediction ? Chen Keasar BGU Any educational usage of these slides is welcomed. Please acknowledge.
Protein Structure Prediction: Threading and Rosetta BMI/CS 576 Colin Dewey Fall 2008.
We propose an accurate potential which combines useful features HP, HH and PP interactions among the amino acids Sequence based accessibility obtained.
2. Introduction to Rosetta and structural modeling
Find the optimal alignment ? +. Optimal Alignment Find the highest number of atoms aligned with the lowest RMSD (Root Mean Squared Deviation) Find a balance.
Computational Structure Prediction
1. Introduction to Computational Structural Biology
Protein Structure Prediction and Protein Homology modeling
Protein Structure Prediction
Protein Structures.
Yang Zhang, Andrzej Kolinski, Jeffrey Skolnick  Biophysical Journal 
Rosetta: De Novo determination of protein structure
Protein structure prediction.
2. Introduction to Rosetta and structural modeling
Protein structure prediction
Presentation transcript:

2. Introduction to Rosetta and structural modeling (From Ora Schueler-Furman) Approaches for structural modeling of proteins The Rosetta framework and its prediction modes Cartesian and polar coordinates Sampling (finding the structure) and scoring (selecting the structure)

Structural Modeling of Proteins - Approaches

Prediction of Structure from Sequence Flowchart Comparison of query sequence to nr database Similar to a sequence of known structure? Homology Modeling (Comparative Modeling) No Fold Recognition (Threading) Fits a known fold? Yes Ab initio prediction No

The Rosetta framework and its prediction modes

A short history of Rosetta In the beginning: ab initio modeling of protein structure starting from sequence  Short fragments of known proteins are assembled by a Monte Carlo strategy to yield native-like protein conformations Reliable fold identification for short proteins. Recently improved to high-resolution models (within 2A RMSD) ATCSFFGRKLL…..

A short history of Rosetta Success of ab initio protocol lead to extension to  Protein design  Design of new fold: TOP7  Protein loop modeling; homology modeling  Protein-protein docking; protein interface design  Protein-ligand docking  Protein-DNA interactions; RNA modeling  Many more, e.g. solving the phase problem in Xray crystallography ATCSFFGRKLL…..

The Rosetta Strategy Observation: local sequence preferences bias, but do not uniquely define, the local structure of a protein Goal: mimic interplay of local and global interactions that determine protein structure Local interactions: fragments derived from known structures (sampled for similar sequences/secondary structure propensity) Global (non-local) interactions: buried hydrophobic residues, paired  strands, specific side chain interactions, etc

The Rosetta Strategy Local interactions – fragments – Fragment library representing accessible local structures for all short sequences in a protein chain, derived from known structures Global (non-local) interactions – scoring function – Derived from conformational statistics of known structures

Scoring and Sampling

The basic assumption in structure prediction Native structure located in global minimum (free) energy conformation (GMEC) ➜ A good Energy function can select the correct model among decoys ➜ A good sampling technique can find the GMEC in the rugged landscape E E GMEC Conformation space

Two-Step Procedure 1.Low-resolution step locates potential minima (fast) 2.Cluster analysis identifies broadest basins in landscape 3.High-resolution step can identify lowest energy minimum in the basins (slow) GMEC E E Conformation space

Structure Representation: Equilibrium bonds and angles (Engh & Huber 1991) Centroid: average location of center of mass of side- chain (Centroid | aa, ,  ) No modeling of side chains Fast Low-Resolution Step

Bayes Theorem: Independent components prevent over-counting P(str | seq) = P(str)*P(seq|str) / P(seq) Low-Resolution Scoring Function constant sequence- dependent features sequence- dependent features structure dependent features structure dependent features

Bayes Theorem: P(seq | str) P(str | seq) = P(str) * P(seq | str) / P(seq) Score = S env + S pair + … neighbors: C  -C  <10Ǻ Sequence-Dependent Components Rohl et al. (2004) Methods in Enzymology 383:66 Origin: Simons et al., JMB 1997; Simons et al., Proteins 1999

P(str) P(str | seq) = P(str) * P(seq | str) / P(seq) Score = … + Sr g + Sc  + S vdw + … Structure-Dependent Components

P(str) P(str | seq) = P(str) * P(seq | str) / P(seq) Score = … + S ss + … Structure-Dependent Components

P(str) P(str | seq) = P(str) * P(seq | str) / P(seq) Score = … + S sheet + S hs + … + S rama 10 Structure-Dependent Components

Slow, exact step Locates global energy minimum Structure Representation: All-atom (including polar and non-polar hydrogens, but no water) Side chains as rotamers from backbone-dependent library Side chain conformation adjusted frequently High-Resolution Step Dunbrack 1997

Side chains have preferred conformations They are summarized in rotamer libraries Select one rotamer for each position Best conformation: lowest-energy combination of rotamers High-Resolution Step: Rotamer Libraries Serine  1 preferences t=180 o g - =-60 o g + =+60 o

High-Resolution Scoring Function Major contributions: – Burial of hydrophobic groups away from water – Void-free packing of buried groups and atoms – Buried polar atoms form intra-molecular hydrogen bonds

Packing interactions Score = S LJ(atr + rep) + …. r ij Linearized repulsive part e: well depth from CHARMm19 High-Resolution Scoring Function

Implicit solvation Score = … + S solvation + …. Lazaridis & Karplus, Proteins 1999 solvation free energy density of i polar High-Resolution Scoring Function x ij =(r ij - R i )/ i x ij 2 x ji 2

N H OC d   (Kortemme, 2003; Morozov 2004) Hydrogen Bonds (original function) Score = …. + S hb(srbb+lrbb+sc) + …. sr bb : short range, backbone HB lr bb : long range, backbone HB sc: HB with side chain atom High-Resolution Scoring Function

Hydrogen Bonding Energy Based on statistics from high-resolution structures in the Protein Data Bank (rcsb.org) (Kortemme, Morozov & Baker 2003 JMB) Slide from Jeff Gray ]

Rotamer preference Score = … + S dunbrack + …. Dunbrack, 1997 High-Resolution Scoring Function

One long, generic function …. Score = S env + S pair + Sr g + Sc  + S vdw + S ss + S sheet + S hs + S rama + S hb (srbb + lrbb) + docking_score + S disulf_cent + S r  + S co + S contact_prediction + S dipolar + S projection + S pc + S tether + S  + S  + S symmetry + S splicemsd + ….. docking_score = S d env + S d pair + S d contact + S d vdw + S d site constr + S d + S fab score Score = S LJ(atr + rep) + S solvation + S hb(srbb+lrbb+sc) + S dunbrack + S pair – S ref + S prob1b + S intrares + S gb_elec + S gsolt + S h2o (solv + hb) + S _plane Scoring Function: Summary

Representations of protein structure: Cartesian and polar coordinates Position PHI PSI OMEGA CHI1 CHI2 CHI3 CHI …. … PDB x y z ATOM 490 N GLN A N ATOM 491 CA GLN A C ATOM 492 C GLN A C ATOM 493 O GLN A O ….. ….

2 ways to represent the protein structure Cartesian coordinates (x,y,z; pdb format)  Intuitive – look at molecules in space  Easy calculation of energy score (based on atom- atom distances) – Difficult to change conformation of structure (while keeping bond length and bond angle unchanged) Polar coordinates (  equilibrium angles and bond lengths)  Compact (3 values/residue)  Easy changes of protein structure (turn around one or more dihedral angles) – Non-intuitive – Difficult to evaluate energy score (calculation of neighboring matrix complicated)

A snake in the 2D world Cartesian representation: points: (0,0),(1,1),(1,2),(2,2),(3,3) connections (predefined): 1-2,2-3,3-4,4-5 x y (0,0) (1,1) (1,2) (2,2) (3,3)

A snake in the 2D world Internal coordinates: bond lengths (predefined): √2,1,1,√2 angles: 45 0,90 o,0 o,45 o x y √ x y 45 o 90 o From wikipedia

A snake wiggling in the 2D world Constraint: keep bond length fixed Move in Cartesian representation (0,0),(1,1),(1,2),(2,2),(3,3)  (0,0),(1,1),(1,2),(2,2),(3,0) Bond length changed! x y √2 √3

A snake wiggling in the 2D world Constraint: keep bond length fixed Move in polar coordinates 45 0,90 o,0 o,45 o  45 0,90 o,45 o,45 o Bond length unchanged! Large impact on structure x y

Polar  Cartesian coordinates Convert r and  to x and y (0,0),(1,1),(1,2),(2,2),(3,3) 45 0,90 o,0 o,45 o √2,1,1,√2 x y From wikipedia

Cartesian  polar coordinates Convert x and y to r and  (0,0),(1,1),(1,2),(2,2),(3,3) 45 0,90 o,0 o,45 o √2,1,1,√2 x y

Moving the snake to the 3D world x y Cartesian representation: points: additional z-axis (0,0,0),(1,1,0),(1,2,0),(2,2,0),(3,3,0) connections (predefined): 1-2,2-3,3-4,4-5 Internal coordinates: bond lengths (predefined): √2,1,1,√2 angles: 45 0,90 o,0 o,45 o dihedral angles: 180 0,180 o z Proteins: bond lengths and angles fixed. Only dihedral angles are varied

Dihedral angles Dihedral angles  1 -  4 define side chain From wikipedia Dihedral angle: defines geometry of 4 consecutive atoms (given bond lengths and angles)

What we learned from our snake x y Cartesian representation: Easy to look at, difficult to move – Moves do not preserve bond length (and angles in 3D) Internal coordinates: Easy to move, difficult to see – calculation of distances between points not trivial z Proteins: bond lengths and angles fixed. Only dihedral angles are varied

Solution: toggle CALCULATE ENERGY - Cartesian coordinates: Derive distance matrix (neighbor list) for energy score calculation CALCULATE ENERGY - Cartesian coordinates: Derive distance matrix (neighbor list) for energy score calculation Transform: build positions in space according to dihedral angles PDB x y z ATOM 490 N GLN A N ATOM 491 CA GLN A C ATOM 492 C GLN A C ATOM 493 O GLN A O ….. …. MOVE STRUCTURE - Polar coordinates: introduce changes in structure by rotating around dihedral angle(s) (change  values) MOVE STRUCTURE - Polar coordinates: introduce changes in structure by rotating around dihedral angle(s) (change  values) Position PHI PSI OMEGA CHI1 CHI2 CHI3 CHI …. … Transform: calculate dihedral angles from coordinates (0,0),(1,1),(1,2),(2,2),(3,3)45 0,90 o,0 o,45 o

Cartesian  polar coordinates Position PHI PSI OMEGA CHI1 CHI2 CHI3 CHI4 … …. … PDB x y z … ATOM 490 C GLN A N ATOM 491 N GLY A C ATOM 492 CA GLY A C ATOM 493 O GLY A O ….. …. How to calculate polar from Cartesian coordinates: example  : C’-N-Ca-C – define plane perpendicular to N-Ca (b 2 ) vector – calculate projection of Ca-C (b 3 ) and C’-N (b 1 ) onto plane – calculate angle between projections (0,0),(1,1),(1,2),(2,2),(3,3)45 0,90 o,0 o,45 o

Polar  Cartesian coordinates Position PHI PSI OMEGA CHI1 CHI2 CHI3 CHI4 … …. … PDB x y z … ATOM 490 C GLN A N ATOM 491 N GLY A C ATOM 492 CA GLY A C ATOM 493 O GLY A O ….. …. Find x,y,z coordinates of C, based on atom positions of C’, N and Ca, and a given  value (  : C’-N-Ca-C) create Ca-C vector: – size Ca-C=1.51A (equilibrium bond length) – angle N-Ca-C= 111 o (equilibrium value for N-Ca-C angle) rotate vector around N-Ca axis to obtain projections of Ca-C and N-C’ with wanted  (0,0),(1,1),(1,2),(2,2),(3,3) 45 0,90 o,0 o,45 o

Representation of protein structure Rosetta folding 3 backbone dihedral angles per residue Sampling and minimization in TORSIONAL space: change angle and rebuild, starting from changed angle Build coordinates of structure starting from first atom, according to dihedral angles (and equilibrium bond length and angle) Based on slides by Chu Wang

Representation of protein structure ’3’1’2’8’7’5’6’ Backbone dihedral angles fixed (rigid-body) Rosetta folding 3 backbone dihedral angles per residue Rosetta docking 6 rigid-body DOFs -- 3 translational vectors 3 rotational angles Sampling and minimization in TORSIONAL space Sampling and minimization in RIGID-BODY space How can those two types of degrees of freedom be combined?

Fold tree representation “long-range” edge – 6 rigid-body DOFs 4’3’1’2’8’7’5’6’ “peptide” edge – 3 backbone dihedral angles Example: fold-tree based docking  Originally developed to improve sampling of strand registers in  -sheet proteins.  Allows simultaneous optimization of rigid-body and backbone/sidechain torsional degrees of freedom. Fold tree: Bradley and Baker, Proteins (2006) 4’3’1’2’8’7’5’6’  Construct fold-trees to treat a variety of protein folding and docking problems.

Fold-trees for different modeling tasks protein folding NC N: N-terminal; C: C-terminal; X: chain break; O: root of the tree; Flexible “peptide” edgerigid “peptide” edge 11’ rigid “jump” 11’ flexible “jump” Color – flexible bb Gray – fixed bb

Fold-trees for different modeling tasks N11’C22’xx loop modeling N: N-terminal; C: C-terminal; X: chain break; O: root of the tree; Flexible “peptide” edgerigid “peptide” edge 11’ rigid “jump” 11’ flexible “jump” Color – flexible bb Gray – fixed bb

Fold-trees for different modeling tasks N1C N1’C fully flexible docking N: N-terminal; C: C-terminal; X: chain break; O: root of the tree; Flexible “peptide” edgerigid “peptide” edge 11’ rigid “jump” 11’ flexible “jump” N1C N1’C docking w/ hinge motion N1 N1’C 22’xC 3’3x docking w/ loop modeling Color – flexible bb Gray – fixed bb

Fold-trees for different modeling tasks Color – flexible bb Gray – fixed bb Pale – symmetry operation

Fold-trees for different modeling tasks Color – flexible bb Gray – fixed bb Filled colored circles - flexible sc

Fold-trees for different modeling tasks Color – flexible bb Gray – fixed bb Filled colored circles - flexible sc o empty colored circles – flexible amino acid: design

Fold-trees for different modeling tasks Color – flexible bb Gray – fixed bb Filled colored circles - flexible sc o empty colored circles – flexible amino acid: design

The Rosetta sampling strategy: a general overview 9 residue fragments 3 residue fragments Gradual addition of parameters to scoring function Quick quenching Fragment Sampling Strategies to keep fragment insertion/perturbation local Monte Carlo (MC) Sampling MC sampling with minimization Local optimization Repacking and refinement Side chain rearrangement