Figure S1. Effects of AVG, DIECA, DPI, NMMA, STA, and OKA on IbRPK expression in sweet potato (Ipomoea batatas cv. Tainung 57). Leaves with petiole cuts.

Slides:

Advertisements

Similar presentations

Supplementary figure S3. Diagram showing the effects of removing data from particular organ types on the relative percentage of gene pairs showing reciprocal.

Advertisements

Protein Structure Investigating DFR specificity in anthocyanin biosynthesis Fazeeda Hosein Sarasvati BahadurSingh Nigel Jalsa Cecilia Diaz David Gopaulchan.

Suppl. Fig. S1 Suppl. Fig. S1 The nucleotide sequence and its deduced amino acid sequences of CaSAMDC. The full-length of CaSAMDC (GenBank Accession No.

WT L2 L3 L4 L5 L6 L15 L21 L23 L2 L5 L7 L8 BnSTM BrSTM BoSTM AtUBQ10 B A Supplementary Fig. 1 C WT L2 L3 L WTL2L5L7L WTL5L6L15L21.

Structural, functional and evolutionary analysis of the unusually large stilbene synthase gene family in grapevine (Vitis vinifera) Claire Parage 1*, Raquel.

Figure S1. Genomic PCR of in vitro potato plants transformed with StPTB1 prom (top) and StPTB6 prom (bottom) constructs using nptII-specific primers. Thirty.

Enzyme activity (μmol mg protein-1 min -1 ) DAA Xu-142 Xu-142 fl mutant CIN VIN CWIN (C) Supplemental Figure 1 Control.

The WRKY superfamily of plant transcription factors.

MVKFLFSVIILFFLLSAVGSSARNIEEDGVIRLPSEVKDFINGKNIDDDSVGGTRWAVLI 60 AGSSGYWNYRHQADVCHAYQVLKRGGVKDENIVVFMYDDIALNEENPRPGVIINHPKGED 120 VYAGVPKDYTGRDVTAHNFYSVLLGNKTAVKGGSGKVIDSGPNDHIFIYYSDHGGPGVLG.

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

Rice SCAMP1 Defines Clathrin-Coated, trans- Golgi–Located Tubular- Vesicular Structures as an Early Endosome in Tobacco BY-2 Cells.

Protein Kinases Primary elements in signal transduction

Fig. S1. Amino acid sequence alignment of MYBS3 proteins. MYBS3 protein sequences of Arabidopsis thaliana (MYBH; NP_199550); (At3g16350; NP_188256), Glycine.

DAD1L1L2L3L4L5DGL 0 9 Relative mRNA levels A DAD1L1L2L3L4L5DGL 0 6 Relative mRNA levels B Wounded Untreated MeJA Mock Plant Cell.

Ctcgaacttgtttttggttcatctctcaaaaccaaaatcactaaagaggagaagattgctaaagtttgataaaacattccaaaatca ATGGCTGATAGGATCAAAGGTCCATGGAGTCCTGAAGAAGACGAGCAGCTTCGTAGGCTTGTTGTTAAATACGGTCCAAGAAACTGG.

Fig. S1. Carotenoid and chlorophyll composition of Arabidopsis Z-ISO mutants compared to wild type. Seedlings were grown for 6d on half strength MS plus.

Arabidopsis Thaliana A Study of Genes and Embryo Development By Garen Polatoglu.

Supporting Fig. S1 OsRHR-GFP GFP ChlorophyllMerge GC Hoechst Merge GH Supporting Figure S1. The OsPHR-GFP fusion protein localizes to nuclei, chloroplasts,

Supporting Figure S1A. Supporting Figure S1B: AtNCL 0.1 Supporting Figure S1. (a): Sequence alignment of AtNCL. Alignment of Arabidopsis AtNCL with proteins.

Supplementary Fig. 1. (A) PCR amplification of wheat TaHSP26 genomic, cDNA and ORF clones. (B) ORF and protein sequence of TaHSP26. An arrowhead indicates.

Louis et al. Figure S1 Mean expression intensity Figure S1. MPL1 expression in Arabidopsis organs The Genevestigator tool (

Characterization of the Nicotiana benthamiana chromomethyltransferase genes, NbCMT3s, in leaf development by virus-induced gene silencing Abstract Results.

Volume 5, Issue 2, Pages (March 2012)

Supplemental Fig. S1 A B AtMYBS aa AtMYBS

Fig. 1. Alignment of NaHD20 amino acid sequences with HD-Zip I proteins from different plant species. Multiple alignment of the NaHD20 amino acid sequence.

Volume 2, Issue 5, Pages (September 2009)

Figure 1. drb7.2 mutant plants display altered accumulation of endoIR-siRNA. Wild-type (Col-0) and drb7.2 mutant plants were subjected to high throughput.

* * * Fig. S1 XB21-Os12g36180 Os11g43950 At4g12770 At4g

AtIAA18 AtIAA6 AtIAA19 VvIAA19 AtIAA10 AtIAA20 AtIAA7 AtIAA30 AtIAA11

a. ZEP ZEP Os04g Selmo Phypa Chlre CTF2B

Figure S1. Sequence alignment of Arabidopsis NodGS with other plant and fungal orthologues. Abbreviations are as follows: Populus trichocarpa (Ptr), Ricinus.

Volume 6, Issue 4, Pages (October 2000)

Volume 6, Issue 3, Pages (May 2013)

Zhu Hui-Fen , Fitzsimmons Karen , Khandelwal Abha , Kranz Robert G.

Volume 5, Issue 2, Pages (March 2012)

Volume 3, Issue 4, Pages (July 2010)

Volume 3, Issue 3, Pages (May 2010)

Volume 5, Issue 1, Pages (January 2012)

Volume 17, Issue 18, Pages (September 2007)

Volume 5, Issue 2, Pages (March 2012)

Volume 2, Issue 4, Pages (July 2009)

Volume 2, Issue 5, Pages (September 2009)

Volume 120, Issue 2, Pages (January 2005)

Features of the Protein Encoded by the Ruby Transcript

The PHANTASTICA Gene Encodes a MYB Transcription Factor Involved in Growth and Dorsoventrality of Lateral Organs in Antirrhinum Richard Waites, Harinee.

Volume 89, Issue 7, Pages (June 1997)

Qiong A. Liu, Michael O. Hengartner Current Biology

Volume 6, Issue 6, Pages (November 2013)

A Novel Class of MYB Factors Controls Sperm-Cell Formation in Plants

Marco Trujillo, Kazuya Ichimura, Catarina Casais, Ken Shirasu

Volume 7, Issue 2, Pages (February 2014)

CARPEL FACTORY, a Dicer Homolog, and HEN1, a Novel Protein, Act in microRNA Metabolism in Arabidopsis thaliana Wonkeun Park, Junjie Li, Rentao Song,

Posttranscriptional Gene Silencing Is Not Compromised in the Arabidopsis CARPEL FACTORY (DICER-LIKE1) Mutant, a Homolog of Dicer-1 from Drosophila E.Jean.

Analysis of GFP expression in gfp loss-of-function mutants.

Expression of the AREB1 Gene and Subcellular Localization of the AREB1 Protein.(A) Structure of AREB1 family proteins. Expression of the AREB1 Gene and.

Stella Plakidou-Dymock, David Dymock, Richard Hooley Current Biology

PtrHB7, a class III HD-Zip Gene, Plays a Critical Role in Regulation of Vascular Cambium Differentiation in Populus Yingying Zhu, Dongliang Song, Jiayan.

Volume 2, Issue 2, Pages (March 2009)

SUR-8, a Conserved Ras-Binding Protein with Leucine-Rich Repeats, Positively Regulates Ras-Mediated Signaling in C. elegans Derek S Sieburth, Qun Sun,

Volume 14, Issue 9, Pages (May 2004)

Volume 6, Issue 2, Pages (March 2013)

Volume 3, Issue 3, Pages (May 2010)

New microsome-associated HT-family proteins from Nicotiana respond to pollination and define an HT/NOD-24 protein family Kondo Katsuhiko , McClure Bruce.

Volume 2, Issue 1, Pages (January 2009)

The NB-ARC domain: a novel signalling motif shared by plant resistance gene products and regulators of cell death in animals Erik A. van der Biezen,

Autophagy Activation Is Mediated by the Secretion of T3Es.

Volume 2, Issue 6, Pages (November 2009)

Volume 3, Issue 2, Pages (March 2010)

Volume 1, Issue 5, Pages (September 2008)

Pst Activates Autophagy to Enhance Plant Susceptibility.

Presentation transcript:

Figure S1. Effects of AVG, DIECA, DPI, NMMA, STA, and OKA on IbRPK expression in sweet potato (Ipomoea batatas cv. Tainung 57). Leaves with petiole cuts were immersed in water for 12 h, and then treated water, 0.88 mM AVG (a), 10 mM DIECA (a), 100 μM DPI (b), 500 μM NMMA (b), 1 μM STA (c), or 0.5 μM OKA (c) for another 12 h. Then, these leaves were unwounded (W-) or wounded (W+) by tweezers. The total RNAs of these leaves were analyzed by RT-PCR 0.5 h later. AVG is an ethylene biosynthesis inhibitor, DIECA is a JA biosynthesis inhibitor, DPI is a NADPH oxidase inhibitor, NMMA is a NOS inhibitor, STA is a protein kinase inhibitor, and OKA is a protein phosphatase inhibitor. The expression of IbActin in each assay was also analyzed by RT-PCR, and was treated as a loading control.

Figure S2. Secondary structure and sequence comparison of miR828 precursor. (a) Secondary structure of miR828 precursor was predicted by mfold (Zuker, 2003). The line indicates the position of the mature miR828. (b) Sequence comparison of miR828. Sequence comparisons were produced by MEGALIGN. Sequences identical are displayed as white letters in black boxes. Ib-premiR828 was compared with those encoding premiR828 in Arabidopsis thaliana, Arabidopsis lyrata, Salvia sclarea, and Vitis vinifera.

Figure S3. Putative conserved domains in IbRPK, IbTLD, and IbMYB. NCBI Conserved Domain Database (CDD) was used. (a) IbRPK contains Leucine rich repeat N- terminal domain and catalytic domain of protein kinase. (b) IbTLD contains TLDc domain. (c) IbMYB contains SANT domain.

Figure S4. The expression patterns of IbMYB-siRNA, IbTLD-siRNA, and miR828 in the leaves of wild type sweet potato (Ipomoea batatas cv. Tainung 57) upon wounding. The third fully expanded leaves were wounded by tweezers for 0 (W-), 0.5, 1, 3, and 6 h. The total RNAs from wounded leaves at the time indicated were analyzed by northern blotting for detecting miR828, IbMYB-siRNA (a), IbTLD-siRNA (b), and 5S rRNA. The values of miR828 and siRNA were adjusted by their corresponding amount of 5S rRNA for equality of loading. After the adjustment by 5S rRNA, the reaction with the unwounded leaves was treated as the normalized reference, with a value of one, for determining the relative amount of miR828 and siRNA.

Figure S5. Phylogenetic analyses of IbMYB and IbTLD. Phylogenetic trees were produced by MEGA 4.0 programs. (a) Phylogenetic analysis of IbMYB protein. IbMYB was compared with those encoding other R2R3-type MYB factors in Arabidopsis thaliana and Ipomoea batatas, which include AtMYB4 (NP_195574), AtMYB7 (NP_179263), AtMYB6 (NP_192684), AtMYB32 (NP_195225), AtMYB1 (NP_187534), AtMYB113 (NP_176811), AtMYB90 (NP_176813), AtMYB114 (NP_176812), AtMYB75 (NP_176057), and IbMYB1 (BAG68212). (b) Phylogenetic analysis of IbTLD protein. IbTLD was compared with those encoding similar proteins in various plant species, which include At4g39870 (NP_195697) from Arabidopsis thaliana, RCOM (XP_ ) from Ricinus communis, POPTRDRAFT (XM_ ) and POPTRDRAFT (XM_ ) from Populus trichocarpa, LOC (XM_ ) from Vitis vinifera, and Os02g (NP_ ) and Os06g (NP_ ) from Oryza sativa.

Figure S6. Protein sequence comparisons of miR828 targets, IbMYB and IbTLD.

Figure S6. Protein sequence comparisons of miR828 targets, IbMYB and IbTLD. (continued) Protein sequence comparisons were produced by MEGALIGN. Amino acid residues identical to those in target proteins are displayed as white letters in black boxes. (a) IbMYB was compared with those encoding R2R3-type MYB factors in Arabidopsis thaliana and Ipomoea batatas, which include AtMYB4 (NP_195574), AtMYB7 (NP_179263), AtMYB6 (NP_192684), AtMYB32 (NP_195225), AtMYB1 (NP_187534), AtMYB113 (NP_176811), AtMYB90 (NP_176813), AtMYB114 (NP_176812), AtMYB75 (NP_176057), and IbMYB1 (BAG68212). (b) IbTLD was compared with those encoding similar proteins in various plant species, which include At2g05590 (NP_849938) and At4g39870 (NP_195697) from Arabidopsis thaliana, RCOM (XP_ ) from Ricinus communis, POPTRDRAFT (XM_ ) and POPTRDRAFT (XM_ ) from Populus trichocarpa; LOC (XM_ ) from Vitis vinifera; and Os02g (NP_ ) and Os06g (NP_ ) from Oryza sativa.

Figure S7. The expression patterns of the phenylpropanoid pathway genes and antioxidant enzyme genes in transgenic tobacco (Nicotiana tabacum L. cv. W38) overexpressing IbMYB and IbTLD. The total RNAs from Wild-Type (W38) and transgenics overexpressing IbMYB (IbMYB-1 and IbMYB-2) or IbTLD (IbTLD-1 and IbTLD-2) were used to detect the phenylpropanoid pathway genes, antioxidant enzyme genes, and NtActin expression using quantitative RT- PCR. The expression levels of NtActin were used as controls for quantitative comparison.