PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

Slides:

Advertisements

Similar presentations

The Build-up of the Red Sequence at z

Advertisements

Multiple alignment June 29, 2007 Learning objectives- Review sequence alignment answer and answer questions you may have. Understand how the E value may.

Fig. S1 A622 1 MVVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVT 60 A622L V V A622.

Arabidopsis Gene Project GK-12 April Workshop Karolyn Giang and Dr. Mulligan.

Multiple Sequence Alignment May 12, 2009 Announcements Quiz #2 return (average 30) Hand in homework #7 Learning objectives-Understand ClustalW Homework#8-Due.

Chapter 8 Molecular Phylogenetics: Measuring Evolution.

Construction of Substitution Matrices

Chapter 24: Molecular and Genomic Evolution CHAPTER 24 Molecular and Genomic Evolution.

Basic Local Alignment Search Tool BLAST Why Use BLAST?

GeneEnsembl Gene IDPrimer sequenceAmplicon size(BP) DDAH1ENSMUSG Forward (5'to 3') CCCAGCAAAGGGCATGTC Reverse (5' to 3') CCATCTCCGAGTTGCTCACA.

A B C D E F G H I J K FigS1. Supplemental Figure S1. Evolutionary relationships of Arabidopsis and tomato Aux/IAA proteins. The evolutionary history was.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

SC.912.L.16.3 DNA Replication. – During DNA replication, a double-stranded DNA molecule divides into two single strands. New nucleotides bond to each.

Bioinformatics What is a genome? How are databases used? What is a phylogentic tree?

Figure 1 Myotubularin exhibits a tyrosine phosphatase activity

Supplemental Fig. S1 A B AtMYBS aa AtMYBS

C acaatataATGGAGCGTGAGACTTCGTCATCTTCAACTCCTCCGGAGGATCTTGTTACATCGATGATCGGAAAGTTCGTCGCTGTCATGTCTA b acaatataATGGAGCGTGAGACTTCGTCATCTTCAACTCCTCCGGAGGATCTTGTTACATCGATGATCGGAAAGTTCGTCGCTGTCTTGTCTA.

Variation among organisms

Figure 1. Structure of the fly LGR2 gene and the corresponding cDNA sequence. A, Derivation of the fly LGR2 full-length cDNA from the genomic sequence.

Supporting Figure S4 (A) (B) (C) LOC_Os03G04630 LOC_Os03G04640

Fig. 1. (A) The nucleotide and deduced amino acid sequences of the vacuolar serine protease protein of F. proliferatum (Fus p , GenBank accession.

Pipelines for Computational Analysis (Bioinformatics)

* * * Fig. S1 XB21-Os12g36180 Os11g43950 At4g12770 At4g

Sequence and structure relatedness of matrix protein of human respiratory syncytial virus with matrix proteins of other negative-sense RNA viruses K.

Protein Alignments: Clues to Protein Function

Mutations Chapter 12-4.

Protein-Truncation Mutations in the RP2 Gene in a North American Cohort of Families with X-Linked Retinitis Pigmentosa Alan J. Mears, Linn Gieser, Denise.

Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,

Bioinformatics and BLAST

Volume 14, Issue 5, Pages (March 2004)

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

Multiple sequence alignment and analysis of SOFL proteins.

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

Volume 57, Issue 5, Pages (May 2000)

Essential Question: How cells make proteins

Basic Local Alignment Search Tool

Psoriasis Upregulated Phorbolin-1 Shares Structural but not Functional Similarity to the mRNA-Editing Protein Apobec-1 Peder Madsen, Julio E. Celis,

A Novel Mouse Gene, Sh3yl1, is Expressed in the Anagen Hair Follicle

Size Polymorphisms in the Human Ultrahigh Sulfur Hair Keratin-Associated Protein 4, KAP4, Gene Family Naoyuki Kariya, Yutaka Shimomura, Masaaki Ito

Figure 1: The full-length cDNA and deduced amino acid sequences of Lysozyme C and amino acid sequences from rock bream, Oplegnathus fasciatus. The primers.

A Novel Family of Candidate Pheromone Receptors in Mammals

Supplemental Figure 3 A B C T-DNA 1 2 RGLG1 2329bp 3 T-DNA 1 2 RGLG2

Schematic diagrams of genomic structure, the strategy for genomic cDNA cloning, and molecular characterization of unique features of three emergent U.S.

Volume 28, Issue 2, Pages e5 (January 2018)

Structural evidence: Embryonic similarities Vestigial organs

Where would you draw the polyA tail in the gene above?______________

Expression of a microRNA-Resistant Target Transgene Misrepresents the Functional Significance of the Endogenous microRNA: Target Gene Relationship Junyan.

Sequence and structure relatedness of matrix protein of human respiratory syncytial virus with matrix proteins of other negative-sense RNA viruses K.

Sadaf Naz, Chantal M. Giguere, David C. Kohrman, Kristina L

Phylogenetic tree of 38 Pseudomonas type strains, based on the V3-V5 region sequence of the 16S rRNA gene (V3 primer, positions 442 to 492; and V5 primer,

Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Protein sequence alignments for the BcfD (A) and StfH (B) allelic.

Cell Signalling: Receptor orphans find a family

WES identification of heterozygous compound mutations in ALPI

Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development K. Kosaki,

WES identification of heterozygous compound mutations in ALPI

iraL shares sequence identity with iraM from E

Identification of the GCS1 ortholog in Gonium pectorale.

Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.

Kun Wang, Bing Zhou, Yien-Ming Kuo, Jason Zemansky, Jane Gitschier

Figure 1 Pedigree and genetic findings

Volume 2, Issue 1, Pages 1-4 (January 1994)

Nucleotide alignment of 3′ untranslated region (UTR) for four crustacean Rheb genes. Nucleotide alignment of 3′ untranslated region (UTR) for four crustacean.

Structure of PrfA (A) and its target DNA sequences in PrfA-regulated promoters (B). Structure of PrfA (A) and its target DNA sequences in PrfA-regulated.

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Nucleotide and predicted amino acid sequence of the adult mouse brain cdr2 cDNA. Nucleotide and predicted amino acid sequence of the adult mouse brain.

Mutations in the Human Orthologue of the Mouse underwhite Gene (uw) Underlie a New Form of Oculocutaneous Albinism, OCA4 J.M. Newton, Orit Cohen-Barak,

(A) Bayesian phylogenetic tree of the H gene nucleotide alignment from tigers Pt2004 and Pt and representative CDV sequences obtained from GenBank.

Volume 97, Issue 6, Pages (June 1999)

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 Figure S1. Protein sequence alignment among PfDGAT1-1 (isotig11157), PfDGAT1-2 (isotig11156), AtDGAT1 (At2g19450), and RcDGAT1 (XP_ ). Black shading indicates identical amino acids. Gray shading indicates similar amino acids and no shading indicates dissimilar amino acids. Dashes indicate gaps in alignment.

PfDGAT2 AtDGAT2 RcDGAT2 PfDGAT2 AtDGAT2 RcDGAT2 PfDGAT2 AtDGAT2 RcDGAT2 PfDGAT2 AtDGAT2 RcDGAT2 PfDGAT2 AtDGAT2 RcDGAT2 PfDGAT2 AtDGAT2 RcDGAT2 Figure S2. Protein sequence alignment among PfDGAT2 (isotig19956), AtDGAT2 (At3g51520), and RcDGAT2 (XP_ ).

PfDGAT3 AtDGAT3 AhDGAT3 PfDGAT3 AtDGAT3 AhDGAT3 PfDGAT3 AtDGAT3 AhDGAT3 PfDGAT3 AtDGAT3 VADGAT3 PfDGAT3 AtDGAT3 AhDGAT3 PfDGAT3 AtDGAT3 AhDGAT3 PfDGAT3 AtDGAT3 AhDGAT3 Figure S3. Protein sequence alignment among PfDGAT3 (isotig08903), AtDGAT3 (At1g48300), and AhDGAT3 (AAX62735).

PfPDAT1-1 PfPDAT1-2 PfPDAT1-1 PfPDAT1-2 PfPDAT1-1 PfPDAT1-2 PfPDAT1-1 PfPDAT1-2 PfPDAT1-1 PfPDAT1-2 PfPDAT1-1 PfPDAT1-2 PfPDAT1-1 PfPDAT1-2 PfPDAT1-1 PfPDAT1-2 PfPDAT1-1 PfPDAT1-2 PfPDAT1-1 PfPDAT1-2 PDAT1-1F1 PDAT1-1R1 PDAT1-2F1 PDAT1-2R1 PfPDAT1-1 PfPDAT1-2 PfPDAT1-1 PfPDAT1-2 Figure S4. C-terminal coding region of nucleotide sequence alignment between PfPDAT1-1 (isotig08780) and PfPDAT1-2 (isotig08781). Locations of qRT-PCR primer sequences for each gene are indicated with red arrows.

Amino Acid Substitution per 100 residues AtPDCT PfPDCT RcPDCT PfPDCT AtPDCT RcPDCT PfPDCT AtPDCT RcPDCT PfPDCT AtPDCT RcPDCT PfPDCT AtPDCT RcPDCT PfPDCT AtPDCT RcPDCT PfPDCT AtPDCT RcPDCT PfPDCT AtPDCT RcPDCT A B Figure S5. A. Phylogenetic tree showing relatedness among PfPDCT (isotig25038) (shaded), AtPDCT (At3g15820) RcPDCT (XP_ ). B. Amino acid sequence alignments among the same three sequences. PfPDCT is partial cDNA sequence.