RGD’s Genome Viewer: Definition and Basic Features.

Slides:



Advertisements
Similar presentations
Support.ebsco.com EBSCOhost Digital Archives Viewer Tutorial.
Advertisements

Support.ebsco.com Science Reference Center Tutorial.
EBSCO Discovery Service
Document Properties: adding information to your Microsoft Office documents Step 1: Add information to Document Properties What are Document Properties.
1 NewSouth HR Inquiries Account Code Translation.
MouseMine: Mouse Gene Lists (and a whole lot more) Joel Richardson.
Site Navigation How to find your way around the ‘Agricultural Education and Training Archive’
COMPREHENSIVE Windows Tutorial 3 Personalizing Your Windows Environment.
10 June Manual Door Operation. 10 June Operate Doors Allows you to remotely operate individual doors or sets of doors –Locking –Unlocking.
Disease Portals A Platform for Genetic and Genomic Research Disease and Phenotype Data in the Context of the Genome Victoria Petri, Mary Shimoyama, Andrew.
1 Welcome to the Protein Database Tutorial This tutorial will describe how to navigate the section of Gramene that provides collective information on proteins.
Copyright OpenHelix. No use or reproduction without express written consent1 Organization of genomic data… Genome backbone: base position number sequence.
6 Copyright © 2004, Oracle. All rights reserved. Working with Data Blocks and Frames.
Getting Started Universal Navigation –Conveniently located at the top right of every page Quick Search –Found at the top left of every page Tools –Print.
An introduction to using the AmiGO Gene Ontology tool.
Vocabulary Crossword 2-1 Vocabulary Crossword Puzzle 2-1 Click mouse to advance slides. Press Esc key to close presentation.
POOM / MSCO Tools AM Standard Operating Procedure Web EIS.
Information Services Portal Selecting and Viewing Reports.
Getting started using crystal 00 Month 2006 Insert security classification here.
Copyright OpenHelix. No use or reproduction without express written consent1.
1 Welcome to the Quantitative Trait Loci (QTL) Tutorial This tutorial will describe how to navigate the section of Gramene that provides information on.
MetaLib Tutorial. 2 MetaLib may be used at two different levels – guest users and logged on users. Guest users have limited access to the databases as.
1 The Genome Browser allows you to –Browse the Rice-Japonica, Maize and Arabidopsis genomes. –View the location of a particular feature on the rice genome.
Quick Start Guide: Administrator Advanced Learn about: 1.Creating customized Roles in LOAMS 2.Searching and moving users in the hierarchy 3.Modifying accounts.
Copyright OpenHelix. No use or reproduction without express written consent1.
The UCSC Genome Browser Introduction
Support.ebsco.com EBSCOhost Visual Search Tutorial.
GENOME-CENTRIC DATABASES Daniel Svozil. NCBI Gene Search for DUT gene in human.
Use cases for Tools at the Bovine Genome Database Apollo and Bovine QTL viewer.
UCSC Genome Browser 1. The Progress 2 Database and Tool Explosion : 230 databases and tools 1996 : first annual compilation of databases and tools.
Copyright OpenHelix. No use or reproduction without express written consent1.
Copyright OpenHelix. No use or reproduction without express written consent1.
The generic Genome Browser (GBrowse) A combination database and interactive web page for manipulating and displaying annotations on genomes Developed by.
This tutorial will assist you in creating graphs from downloadable excel files.
MetaLib 4 User Guide. 2 MetaLib 4 Access MetaLib at: – MetaLib may be used at two different levels –
5/14/2003Sprint TekNet IP Train the Trainer1 Open TekNet Software If working at a client station, enter the IP address of the server and mark page as a.
Copyright OpenHelix. No use or reproduction without express written consent1.
Copyright OpenHelix. No use or reproduction without express written consent1.
Metalib Categories Administration. 2 The MetaLib Management interface is used for set up procedures relating to categories. Using the Categories Administration.
A Comparative Genomics Resource for Grains V26. Tutorial Tips If you are viewing this tutorial with Adobe Acrobat Reader, click the "bookmarks" on the.
I NTRODUCTION TO DATABASES - P RACTICAL. Q UERY S EQUENCE >my weird new protein MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT.
Ela Hunt, MRC research fellow Department of Computing Science SyntenyVista BIOINFORMATICS RESEARCH CENTRE.
Copyright OpenHelix. No use or reproduction without express written consent1.
Computing Fundamentals Module Lesson 7 — The Windows Operating System Computer Literacy BASICS.
PROPOSAL SAMSUNG AUDIO. SITEMAP HomeProduct5 product lines product same line Virtual living room Select and choose product put in room Shopping corner.
Copyright OpenHelix. No use or reproduction without express written consent1.
Start with loading the picture Locate your camera’s USB cable –it looks something like this:
Copyright OpenHelix. No use or reproduction without express written consent1.
1 Setting up document titles selection list in EHR 1.Click on Tools 2.Choose Options.
What do we already know ? The rice disease resistance gene Pi-ta Genetically mapped to chromosome 12 Rybka et al. (1997). It has also been sequenced Bryan.
Nurture My Child Tutorial Steps to Creating & Using a Family Account This tutorial has been created for families. It gives you a step-by-step procedure.
Tools in Bioinformatics Genome Browsers. Retrieving genomic information Previous lesson(s): annotation-based perspective of search/data Today: genomic-based.
Copyright OpenHelix. No use or reproduction without express written consent1.
Genomes at NCBI. Database and Tool Explosion : 230 databases and tools 1996 : first annual compilation of databases and tools lists 57 databases.
CHOOSE 1 OF THESE.
Create a Graph Instructions 1.Open data table on flash drive. 2.Position curser within the data table and on the top right corner you should see +. 3.Click.
What Is Firefox? __________ is a Web ___________ that you use to search for and view Web pages, save pages for use in the future, and maintain a list.
THE MOUSE Left Click THE MOUSE Right Click.
ADDING TILES IN UACCESS
Create a Graph Instructions
Using ArrayExpress.
The Human-Mouse: Disease Connection in MGI (BETA)
BOLD 2.0 Navigation Help Guide.
EXPERTIndex™ “Contains” REACH Registrations Advanced
NoodleTools and Diigo.
Volume 8, Issue 1, Pages 9-17 (January 2005)
EXPERTIndex™ “Contains” TOXLINE® Special Advanced
Study Tips ALEKS Training Series Students.
How to access the dashboard: visit
Presentation transcript:

RGD’s Genome Viewer: Definition and Basic Features

Gviewer: Basic Features 1. Definition 2. Accessing GViewer in the Disease Portal 3. What do tool result look like in the Disease Portal? 4. Gene/QTL (feature) Representation 5. Obtain Feature Report Pages using Gviewer 6. Gviewer results for Rat/Human/Mouse 7. Syntenic Views 8. Display Gviewer Help

Definition: Genome Viewer,also called “GViewer”, displays a genomic view of genes and QTLs, annotated to a function, biological process, cellular component, phenotype, disease, or pathway related to the query term Gviewer: Defined

Accessing the GViewer within the Disease Portal Visit The Neurological Portal Homepage Choose Resource Topic –Disease –Phenotype –Biological Process –Pathways Specify Category View Gviewer Results **Gviewer default display on Neurological Disease homepage will be for all annotated diseases.**

GViewer Results Search Criteria: Nervous System Malformations>Neural tube defects

Gene/QTL (feature) Representation  QTLs: Blue Bar  Mouse over for feature details to appear  Blue shading represents location  Genes: Purple Wedge  Mouse over for feature details to appear  Purple line represents location QTL Genes

Obtain Feature report pages using Gviewer 1.Locate feature of Interest 2.Mouse over Feature 3.Shift+right click when feature is highlighted 4.RGD report page corresponding feature will open

Displaying Genome Views for Rat/Human/Mouse and Syntenic Views The following views are based on the search: Neurodegenerative Diseases>Parkinson disease

Rat Gviewer Results (default) Human Gviewer Results Mouse Gviewer Results Gviewer Results for Rat/Human/Mouse Search: Neurodegenerative Diseases>Parkinson disease Display results for different species by clicking species on upper left.

Gviewer Displays Syntenic Views: Neurodegenerative Disease>Parkinson disease Rat Gviewer Results Human Synteny Results Mouse Synteny Results Click to change views Display syntenic results by clicking species synteny on side right

Display GViewer Help Click

Click (i) icon for more Results Flash Gviewer options window appears

Feedback: Privacy Policy Feedback
Do Not Sell My Personal Information
About project: SlidePlayer Terms of Service

© 2025 SlidePlayer.com. Inc. All rights reserved.