Pribnow box (-10) T 89 A 99 T 50 A 65 A 65 T 100  70 binding site (-35) T 85 T 83 G 81 A 61 C 69 A 52.

Slides:

Advertisements

Similar presentations

Chapter 17~ From Gene to Protein

Advertisements

Uses of Cloned Genes sequencing reagents (eg, probes) protein production insufficient natural quantities modify/mutagenesis library screening Expression.

Protein Targetting Prokaryotes vs. Eukaryotes Mutations

Lesson 3: Translation.

Dolly the sheep ( ) 1. Animal and human cloning 2. Gene cloning.

Immunoglobulin Gene Rearrangement MCB720 January 20, 2011 Presented by: Alamzeb Khan & Maria Muccioli

Cloning Using Plasmid Vectors Vector = a molecule used as a vehicle to carry foreign DNA into a host cell Simplest vector = plasmid.

MCB 720: Molecular Biology Eukaryotic gene organization Restriction enzymes Cloning vectors.

10-1 Copyright  2005 McGraw-Hill Australia Pty Ltd PPTs t/a Biology: An Australian focus 3e by Knox, Ladiges, Evans and Saint Chapter 10: The genetic.

Lecture 19-20: Protein Synthesis and the Genetic Code and Synthesis of Membrane Proteins Reading Assignment: Chapter 40 and 43, pgs and ;

Molecular Cloning: Construction of a recombinant DNA

 Type of RNA that functions as an interpreter in translation  Each tRNA molecule has a specific anticodon and a site of attachment for an amino acid.

Foreign Gene Expression and Protein Production in Prokaryotes and Eukaryotes Prokaryotic Expression Systems Fusion Proteins Biofilms Secretion Eukaryotic.

Lecture 3 Lecture 2 catch up Vector structure Copy number control

Expression of clones genes a.o. Primrose & Twyman, 7th edition, pp Primrose, Twyman & Old, 6th edition, pp

Chapter 4 Molecular Cloning Methods. Gene Cloning The Role of Restriction Endonuclease.

FROM DNA TO PROTEIN Transcription – Translation. I. Overview Although DNA and the genes on it are responsible for inheritance, the day to day operations.

Protein Synthesis: Ch 17 From : Kevin Brown – University of Florida

Lecture 7 Manipulation of foreign gene and secretion of foreign protein.

Genetics AP Biology. The Discovery of DNA Structure Rosalind Franklin: x-ray diffraction photographs of DNA Rosalind Franklin: x-ray diffraction photographs.

Protein Synthesis. Transcription DNA  mRNA Occurs in the nucleus Translation mRNA  tRNA  AA Occurs at the ribosome.

Ch. 17 From Gene to Protein. Genes specify proteins via transcription and translation DNA controls metabolism by directing cells to make specific enzymes.

Chapter 8 Lecture Outline

Amino acids are coded by mRNA base sequences.

Essential Basic Part Types Coding Sequences (C) - Complete open reading frames (type I), or sequences encoding polypeptides but lacking either a stop codon.

Prediction of Protein Binding Sites in Protein Structures Using Hidden Markov Support Vector Machine.

Rational Design of a Fusion Partner for Membrane Protein

Figure S1. Effect of the plasmid copy number on silencing of lacZ. (A) For the LacZ assay, wild-type cells were transformed with plasmids harboring the.

Fusion Protein Want to Coat Bacteria with Proteins of Interest Surface Display: Fusions to Membrane Proteins Strept Binding Peptides Histidine Tag Random.

Scientists alter DNA of orgs to produce wanted effects. 3 steps: cut the DNA, combine DNA, and fuse DNA into a living cell. Introduction.

Engineering magnetosomes to express novel proteins Which ones? Must be suitable for expressing in Magnetospyrillum! Can’t rely on glycosylation, disulphide.

AP Biology Plasmids  Small supplemental circles of DNA  ,000 base pairs  self-replicating  carry extra genes  2-30 genes  genes for antibiotic.

CLONING VECTORS Shumaila Azam. IMPORTANT CLONING VECTORS.

Engineering magnetosomes to express novel proteins Which ones? Must be suitable for expressing in Magnetospyrillum! Can’t rely on glycosylation, disulphide.

Engineering magnetosomes to express novel proteins Which ones? Must be suitable for expressing in Magnetospyrillum! Can’t rely on glycosylation, disulphide.

Fundamentals of Genetic Engineering. 2 2 What are vectors? Vectors are DNA molecules that act as destination for GOI. Vectors act as a vehicle to ultimately.

Engineering magnetosomes to express novel proteins Which ones? Must be suitable for expressing in Magnetospyrillum! Can’t rely on glycosylation, disulphide.

From Genes to Genomes: Concepts and Applications of DNA Technology, Jeremy W. Dale, Malcolm von Schantz and Nick Plant. © 2012 John Wiley & Sons, Ltd.

Topics to be covers Basic features present on plasmids

Protein and toxin export and secretion

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Production of Recombinant Proteins

Fig. 1. Adhiron coding region and phagemid vector

Protein engineering and recombinant protein expression

Fusion Proteins Fusion protein Cleavage of fusion proteins

Figure 2. S-tagged SEAP binding to S-protein-coated plates is linear

Fig. 1. The ToxR-based two-hybrid system for the detection of protein–protein interactions in the E.coli periplasm (A) and cytoplasm (B). In fusion with.

Quiz #7 (8%) Biol710 11/21/12 name___________

The Differentiation of Vertebrate Immune Cells

Streptavidin on the cell surface

Codon Recognition tRNA anticodon matched to mRNA codon in the A site.

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

Molecular cloning, expression, and characterization of a major 38-kd cochineal allergen Yoko Ohgiya, MS, Fumihiro Arakawa, MS, Hiroshi Akiyama, PhD, Yasuo.

Gel Retardation.

Determine the Identity of Unknown Plasmids

Translation The sequence of nucleotide bases in an mRNA molecule is a set of instructions that gives the order in which amino acids should be joined to.

Neurexins Are Functional α-Latrotoxin Receptors

Title of notes: Transcription and Translation p. 16 & 17

Both of the N-Terminal and C-Terminal Regions of Human Papillomavirus Type 16 E7 are Essential for Immortalization of Primary Rat Cells Toshiharu Yamashita,

Surface Engineered Bacteria Engineered to Bind and Signal

iGEM Meeting #3 07/09/08 Presentation by Robert Ovadia

Lecture #7 Date _________

Inactivation of the Dp1 locus.

Extracellular Proteins Needed for C. elegans Mechanosensation

Binding of p38α and p38β2 to MAP kinase kinases

Thomas Gaj, Benjamin E Epstein, David V Schaffer Molecular Therapy

Translation The sequence of nucleotide bases in an mRNA molecule is a set of instructions that gives the order in which amino acids should be joined to.

Structures of wild-type and mutated recombinant CDX2.

Sequence alignment of colicin lysis proteins.

Presentation transcript:

Pribnow box (-10) T 89 A 99 T 50 A 65 A 65 T 100  70 binding site (-35) T 85 T 83 G 81 A 61 C 69 A 52

pMAL vectors : ColE1 ori ; M13 ori ; Ptac ; rrnB terminators ; lacI q ; bla Fusion construct : malE - DDDDDDDDDD - IEGR - MCS - lacZ  pMAL-c2 : malE signal peptide sequence deleted pMAL-p2 : malE signal peptide sequence : secretion to periplasm  fusion in XmnI : exact joining of target protein at factor Xa sequence  10 Asp residues (D) separate the two fusion moieties  insertion in EcoRI is identical (in reading frame) as in gt11 (lacZ) factor Xa I - E - G - R * factor Xa I - E - G - R * XmnI nnn nnn nGA Ann nnT TCn nnn XmnI nnn nnn nGA Ann nnT TCn nnn ATC-GAG-GGA-AGG-ATT-TCA-GAA-TTC- ATC-GAG-GGA-AGG-ATT-TCA-GAA-TTC- EcoRI EcoRI